Anti AKAP12 pAb (ATL-HPA006344 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA006344-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: AKAP12
Alternative Gene Name: AKAP250, SSeCKS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038587: 45%, ENSRNOG00000019549: 44%
Entrez Gene ID: 9590
Uniprot ID: Q02952
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QRAEAERPEEQAEASGLKKETDVVLKVDAQEAKTEPFTQGKVVGQTTPESFEKAPQVTESIESSELVTTCQAETLAGVKSQEMVMEQAIPPDSVETPTDSETDGST |
Gene Sequence | QRAEAERPEEQAEASGLKKETDVVLKVDAQEAKTEPFTQGKVVGQTTPESFEKAPQVTESIESSELVTTCQAETLAGVKSQEMVMEQAIPPDSVETPTDSETDGST |
Gene ID - Mouse | ENSMUSG00000038587 |
Gene ID - Rat | ENSRNOG00000019549 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AKAP12 pAb (ATL-HPA006344 w/enhanced validation) | |
Datasheet | Anti AKAP12 pAb (ATL-HPA006344 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti AKAP12 pAb (ATL-HPA006344 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti AKAP12 pAb (ATL-HPA006344 w/enhanced validation) | |
Datasheet | Anti AKAP12 pAb (ATL-HPA006344 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti AKAP12 pAb (ATL-HPA006344 w/enhanced validation) |
Citations for Anti AKAP12 pAb (ATL-HPA006344 w/enhanced validation) – 2 Found |
Bateman, Nicholas W; Jaworski, Elizabeth; Ao, Wei; Wang, Guisong; Litzi, Tracy; Dubil, Elizabeth; Marcus, Charlotte; Conrads, Kelly A; Teng, Pang-ning; Hood, Brian L; Phippen, Neil T; Vasicek, Lisa A; McGuire, William P; Paz, Keren; Sidransky, David; Hamilton, Chad A; Maxwell, G Larry; Darcy, Kathleen M; Conrads, Thomas P. Elevated AKAP12 in paclitaxel-resistant serous ovarian cancer cells is prognostic and predictive of poor survival in patients. Journal Of Proteome Research. 2015;14(4):1900-10. PubMed |
Lam, K H Brian; Leon, Alberto J; Hui, Weili; Lee, Sandy Che-Eun; Batruch, Ihor; Faust, Kevin; Klekner, Almos; Hutóczki, Gábor; Koritzinsky, Marianne; Richer, Maxime; Djuric, Ugljesa; Diamandis, Phedias. Topographic mapping of the glioblastoma proteome reveals a triple-axis model of intra-tumoral heterogeneity. Nature Communications. 2022;13(1):116. PubMed |