Anti AKAP12 pAb (ATL-HPA006344 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA006344-25

• 
• 
• 

Protein Description: A kinase (PRKA) anchor protein 12
Gene Name: AKAP12
Alternative Gene Name: AKAP250, SSeCKS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038587: 45%, ENSRNOG00000019549: 44%
Entrez Gene ID: 9590
Uniprot ID: Q02952
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QRAEAERPEEQAEASGLKKETDVVLKVDAQEAKTEPFTQGKVVGQTTPESFEKAPQVTESIESSELVTTCQAETLAGVKSQEMVMEQAIPPDSVETPTDSETDGST
• Gene Sequence: QRAEAERPEEQAEASGLKKETDVVLKVDAQEAKTEPFTQGKVVGQTTPESFEKAPQVTESIESSELVTTCQAETLAGVKSQEMVMEQAIPPDSVETPTDSETDGST
• Gene ID - Mouse: ENSMUSG00000038587
• Gene ID - Rat: ENSRNOG00000019549
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AKAP12 pAb (ATL-HPA006344 w/enhanced validation) – 2 Found

Bateman, Nicholas W; Jaworski, Elizabeth; Ao, Wei; Wang, Guisong; Litzi, Tracy; Dubil, Elizabeth; Marcus, Charlotte; Conrads, Kelly A; Teng, Pang-ning; Hood, Brian L; Phippen, Neil T; Vasicek, Lisa A; McGuire, William P; Paz, Keren; Sidransky, David; Hamilton, Chad A; Maxwell, G Larry; Darcy, Kathleen M; Conrads, Thomas P. Elevated AKAP12 in paclitaxel-resistant serous ovarian cancer cells is prognostic and predictive of poor survival in patients. Journal Of Proteome Research. 2015;14(4):1900-10. 

Lam, K H Brian; Leon, Alberto J; Hui, Weili; Lee, Sandy Che-Eun; Batruch, Ihor; Faust, Kevin; Klekner, Almos; Hutóczki, Gábor; Koritzinsky, Marianne; Richer, Maxime; Djuric, Ugljesa; Diamandis, Phedias. Topographic mapping of the glioblastoma proteome reveals a triple-axis model of intra-tumoral heterogeneity. Nature Communications. 2022;13(1):116.