Anti AKAP11 pAb (ATL-HPA039089 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA039089-25
  • Immunohistochemistry analysis in human kidney and skeletal muscle tissues using Anti-AKAP11 antibody. Corresponding AKAP11 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: A kinase (PRKA) anchor protein 11
Gene Name: AKAP11
Alternative Gene Name: AKAP220, DKFZp781I12161, FLJ11304, KIAA0629, PPP1R44, PRKA11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022016: 67%, ENSRNOG00000009987: 64%
Entrez Gene ID: 11215
Uniprot ID: Q9UKA4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EHSGKKVQFAEALATHILSLATEMAASHLDNKIIQEPKVKNPCLNVQSQRSVSPTFLNPSDENLKTLCNFAGDLAAEVITEAEKIAKVRNCM
Gene Sequence EHSGKKVQFAEALATHILSLATEMAASHLDNKIIQEPKVKNPCLNVQSQRSVSPTFLNPSDENLKTLCNFAGDLAAEVITEAEKIAKVRNCM
Gene ID - Mouse ENSMUSG00000022016
Gene ID - Rat ENSRNOG00000009987
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti AKAP11 pAb (ATL-HPA039089 w/enhanced validation)
Datasheet Anti AKAP11 pAb (ATL-HPA039089 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AKAP11 pAb (ATL-HPA039089 w/enhanced validation)