Anti AKAP10 pAb (ATL-HPA028901)

Atlas Antibodies

SKU:
ATL-HPA028901-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells of tubules.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: A kinase (PRKA) anchor protein 10
Gene Name: AKAP10
Alternative Gene Name: D-AKAP2, MGC9414, PRKA10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047804: 75%, ENSRNOG00000002899: 80%
Entrez Gene ID: 11216
Uniprot ID: O43572
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SAQLFMTHSEGIDLNNRTNSTQNHLLLSQECDSAHSLRLEMARAGTHQVSMETQESSSTLTVASRNSPASPLKELSGKLMKSIEQDAVNTFTKYISPDAAKPIPITEAMRNDIIARICGEDGQVDPNCFV
Gene Sequence SAQLFMTHSEGIDLNNRTNSTQNHLLLSQECDSAHSLRLEMARAGTHQVSMETQESSSTLTVASRNSPASPLKELSGKLMKSIEQDAVNTFTKYISPDAAKPIPITEAMRNDIIARICGEDGQVDPNCFV
Gene ID - Mouse ENSMUSG00000047804
Gene ID - Rat ENSRNOG00000002899
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AKAP10 pAb (ATL-HPA028901)
Datasheet Anti AKAP10 pAb (ATL-HPA028901) Datasheet (External Link)
Vendor Page Anti AKAP10 pAb (ATL-HPA028901) at Atlas Antibodies

Documents & Links for Anti AKAP10 pAb (ATL-HPA028901)
Datasheet Anti AKAP10 pAb (ATL-HPA028901) Datasheet (External Link)
Vendor Page Anti AKAP10 pAb (ATL-HPA028901)