Anti AKAP1 pAb (ATL-HPA008691)

Atlas Antibodies

Catalog No.:
ATL-HPA008691-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: A kinase (PRKA) anchor protein 1
Gene Name: AKAP1
Alternative Gene Name: AKAP121, AKAP149, AKAP84, D-AKAP1, PPP1R43, PRKA1, S-AKAP84, SAKAP84, TDRD17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018428: 35%, ENSRNOG00000002373: 35%
Entrez Gene ID: 8165
Uniprot ID: Q92667
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EHVLELENSKGPSLASLEGEEDKGKSSSSQVVGPVQEEEYVAEKLPSRFIESAHTELAKDDAAPAPPVADAKAQDRGVEGELGNEESLDRNEEGLDRNEEGLDRNEESLDRNEEGLDRNEEIKRAAFQIISQVISEATEQV
Gene Sequence EHVLELENSKGPSLASLEGEEDKGKSSSSQVVGPVQEEEYVAEKLPSRFIESAHTELAKDDAAPAPPVADAKAQDRGVEGELGNEESLDRNEEGLDRNEEGLDRNEESLDRNEEGLDRNEEIKRAAFQIISQVISEATEQV
Gene ID - Mouse ENSMUSG00000018428
Gene ID - Rat ENSRNOG00000002373
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AKAP1 pAb (ATL-HPA008691)
Datasheet Anti AKAP1 pAb (ATL-HPA008691) Datasheet (External Link)
Vendor Page Anti AKAP1 pAb (ATL-HPA008691) at Atlas Antibodies

Documents & Links for Anti AKAP1 pAb (ATL-HPA008691)
Datasheet Anti AKAP1 pAb (ATL-HPA008691) Datasheet (External Link)
Vendor Page Anti AKAP1 pAb (ATL-HPA008691)
Citations for Anti AKAP1 pAb (ATL-HPA008691) – 3 Found
Sotgia, Federica; Whitaker-Menezes, Diana; Martinez-Outschoorn, Ubaldo E; Salem, Ahmed F; Tsirigos, Aristotelis; Lamb, Rebecca; Sneddon, Sharon; Hulit, James; Howell, Anthony; Lisanti, Michael P. Mitochondria "fuel" breast cancer metabolism: fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells. Cell Cycle (Georgetown, Tex.). 2012;11(23):4390-401.  PubMed
Aggarwal, Stacey; Gabrovsek, Laura; Langeberg, Lorene K; Golkowski, Martin; Ong, Shao-En; Smith, F Donelson; Scott, John D. Depletion of dAKAP1-protein kinase A signaling islands from the outer mitochondrial membrane alters breast cancer cell metabolism and motility. The Journal Of Biological Chemistry. 2019;294(9):3152-3168.  PubMed
Signorelli, Mirko; Ayoglu, Burcu; Johansson, Camilla; Lochmüller, Hanns; Straub, Volker; Muntoni, Francesco; Niks, Erik; Tsonaka, Roula; Persson, Anja; Aartsma-Rus, Annemieke; Nilsson, Peter; Al-Khalili Szigyarto, Cristina; Spitali, Pietro. Longitudinal serum biomarker screening identifies malate dehydrogenase 2 as candidate prognostic biomarker for Duchenne muscular dystrophy. Journal Of Cachexia, Sarcopenia And Muscle. 2020;11(2):505-517.  PubMed