Anti AKAIN1 pAb (ATL-HPA049365)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049365-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: AKAIN1
Alternative Gene Name: C18orf42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091636: 72%, ENSRNOG00000053805: 75%
Entrez Gene ID: 642597
Uniprot ID: P0CW23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FWLGEKPGNEPEEVKLQNASKQIVQNAILQAVQQVSQESQRREERISDNRDHIQLGVGELTKKHEKK |
Gene Sequence | FWLGEKPGNEPEEVKLQNASKQIVQNAILQAVQQVSQESQRREERISDNRDHIQLGVGELTKKHEKK |
Gene ID - Mouse | ENSMUSG00000091636 |
Gene ID - Rat | ENSRNOG00000053805 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AKAIN1 pAb (ATL-HPA049365) | |
Datasheet | Anti AKAIN1 pAb (ATL-HPA049365) Datasheet (External Link) |
Vendor Page | Anti AKAIN1 pAb (ATL-HPA049365) at Atlas Antibodies |
Documents & Links for Anti AKAIN1 pAb (ATL-HPA049365) | |
Datasheet | Anti AKAIN1 pAb (ATL-HPA049365) Datasheet (External Link) |
Vendor Page | Anti AKAIN1 pAb (ATL-HPA049365) |