Anti AK9 pAb (ATL-HPA036324)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036324-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: AK9
Alternative Gene Name: AKD1, AKD2, C6orf199, C6orf224, dJ70A9.1, FLJ25791, FLJ42177, MGC26954
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091415: 90%, ENSRNOG00000037688: 91%
Entrez Gene ID: 221264
Uniprot ID: Q5TCS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SEWWLKEPIRSTGFILDGFPRYPEEAQFLGDRGFFPDAAVFIQVDDQDIFDRLLPAQIEKWKLKQKKK |
| Gene Sequence | SEWWLKEPIRSTGFILDGFPRYPEEAQFLGDRGFFPDAAVFIQVDDQDIFDRLLPAQIEKWKLKQKKK |
| Gene ID - Mouse | ENSMUSG00000091415 |
| Gene ID - Rat | ENSRNOG00000037688 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AK9 pAb (ATL-HPA036324) | |
| Datasheet | Anti AK9 pAb (ATL-HPA036324) Datasheet (External Link) |
| Vendor Page | Anti AK9 pAb (ATL-HPA036324) at Atlas Antibodies |
| Documents & Links for Anti AK9 pAb (ATL-HPA036324) | |
| Datasheet | Anti AK9 pAb (ATL-HPA036324) Datasheet (External Link) |
| Vendor Page | Anti AK9 pAb (ATL-HPA036324) |