Anti AK9 pAb (ATL-HPA030804 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA030804-25
  • Immunohistochemistry analysis in human testis and liver tissues using Anti-AK9 antibody. Corresponding AK9 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & nuclear membrane.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: adenylate kinase 9
Gene Name: AK9
Alternative Gene Name: AKD1, AKD2, C6orf199, C6orf224, dJ70A9.1, FLJ25791, FLJ42177, MGC26954
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091415: 73%, ENSRNOG00000037688: 72%
Entrez Gene ID: 221264
Uniprot ID: Q5TCS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VMAEHNPQYLIELNGNKPAEELFMIVMDRLKYLNLKRAAILTKLQGAEEEINDTMENDELFRTLASYKLIAPRYRWQRSKWG
Gene Sequence VMAEHNPQYLIELNGNKPAEELFMIVMDRLKYLNLKRAAILTKLQGAEEEINDTMENDELFRTLASYKLIAPRYRWQRSKWG
Gene ID - Mouse ENSMUSG00000091415
Gene ID - Rat ENSRNOG00000037688
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AK9 pAb (ATL-HPA030804 w/enhanced validation)
Datasheet Anti AK9 pAb (ATL-HPA030804 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AK9 pAb (ATL-HPA030804 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AK9 pAb (ATL-HPA030804 w/enhanced validation)
Datasheet Anti AK9 pAb (ATL-HPA030804 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AK9 pAb (ATL-HPA030804 w/enhanced validation)