Anti AK8 pAb (ATL-HPA021443)

Atlas Antibodies

Catalog No.:
ATL-HPA021443-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: adenylate kinase 8
Gene Name: AK8
Alternative Gene Name: C9orf98, FLJ32704
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026807: 78%, ENSRNOG00000012761: 79%
Entrez Gene ID: 158067
Uniprot ID: Q96MA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TGERYHLMYKPPPTMEIQARLLQNPKDAEEQVKLKMDLFYRNSADLEQLYGSAITLNGDQDPYTVFEYIESGIINPLPKKIP
Gene Sequence TGERYHLMYKPPPTMEIQARLLQNPKDAEEQVKLKMDLFYRNSADLEQLYGSAITLNGDQDPYTVFEYIESGIINPLPKKIP
Gene ID - Mouse ENSMUSG00000026807
Gene ID - Rat ENSRNOG00000012761
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AK8 pAb (ATL-HPA021443)
Datasheet Anti AK8 pAb (ATL-HPA021443) Datasheet (External Link)
Vendor Page Anti AK8 pAb (ATL-HPA021443) at Atlas Antibodies

Documents & Links for Anti AK8 pAb (ATL-HPA021443)
Datasheet Anti AK8 pAb (ATL-HPA021443) Datasheet (External Link)
Vendor Page Anti AK8 pAb (ATL-HPA021443)