Anti AK8 pAb (ATL-HPA021443)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021443-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: AK8
Alternative Gene Name: C9orf98, FLJ32704
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026807: 78%, ENSRNOG00000012761: 79%
Entrez Gene ID: 158067
Uniprot ID: Q96MA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TGERYHLMYKPPPTMEIQARLLQNPKDAEEQVKLKMDLFYRNSADLEQLYGSAITLNGDQDPYTVFEYIESGIINPLPKKIP |
Gene Sequence | TGERYHLMYKPPPTMEIQARLLQNPKDAEEQVKLKMDLFYRNSADLEQLYGSAITLNGDQDPYTVFEYIESGIINPLPKKIP |
Gene ID - Mouse | ENSMUSG00000026807 |
Gene ID - Rat | ENSRNOG00000012761 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AK8 pAb (ATL-HPA021443) | |
Datasheet | Anti AK8 pAb (ATL-HPA021443) Datasheet (External Link) |
Vendor Page | Anti AK8 pAb (ATL-HPA021443) at Atlas Antibodies |
Documents & Links for Anti AK8 pAb (ATL-HPA021443) | |
Datasheet | Anti AK8 pAb (ATL-HPA021443) Datasheet (External Link) |
Vendor Page | Anti AK8 pAb (ATL-HPA021443) |