Anti AK6 pAb (ATL-HPA070217)

Atlas Antibodies

Catalog No.:
ATL-HPA070217-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: adenylate kinase 6
Gene Name: AK6
Alternative Gene Name: CINAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078941: 83%, ENSRNOG00000039848: 80%
Entrez Gene ID: 102157402
Uniprot ID: Q9Y3D8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIE
Gene Sequence TNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIE
Gene ID - Mouse ENSMUSG00000078941
Gene ID - Rat ENSRNOG00000039848
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AK6 pAb (ATL-HPA070217)
Datasheet Anti AK6 pAb (ATL-HPA070217) Datasheet (External Link)
Vendor Page Anti AK6 pAb (ATL-HPA070217) at Atlas Antibodies

Documents & Links for Anti AK6 pAb (ATL-HPA070217)
Datasheet Anti AK6 pAb (ATL-HPA070217) Datasheet (External Link)
Vendor Page Anti AK6 pAb (ATL-HPA070217)