Anti AK5 pAb (ATL-HPA057255 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA057255-25
  • Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-AK5 antibody. Corresponding AK5 RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: adenylate kinase 5
Gene Name: AK5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039058: 91%, ENSRNOG00000046947: 92%
Entrez Gene ID: 26289
Uniprot ID: Q9Y6K8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVD
Gene Sequence VVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVD
Gene ID - Mouse ENSMUSG00000039058
Gene ID - Rat ENSRNOG00000046947
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AK5 pAb (ATL-HPA057255 w/enhanced validation)
Datasheet Anti AK5 pAb (ATL-HPA057255 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AK5 pAb (ATL-HPA057255 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AK5 pAb (ATL-HPA057255 w/enhanced validation)
Datasheet Anti AK5 pAb (ATL-HPA057255 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AK5 pAb (ATL-HPA057255 w/enhanced validation)