Anti AK5 pAb (ATL-HPA057255 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA057255-25

Protein Description: adenylate kinase 5
Gene Name: AK5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039058: 91%, ENSRNOG00000046947: 92%
Entrez Gene ID: 26289
Uniprot ID: Q9Y6K8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVD
• Gene Sequence: VVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVD
• Gene ID - Mouse: ENSMUSG00000039058
• Gene ID - Rat: ENSRNOG00000046947
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.