Anti AK5 pAb (ATL-HPA019128 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA019128-25
  • Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-AK5 antibody. Corresponding AK5 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line LHCN-M2 shows localization to cytosol.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and AK5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403569).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: adenylate kinase 5
Gene Name: AK5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039058: 84%, ENSRNOG00000046947: 83%
Entrez Gene ID: 26289
Uniprot ID: Q9Y6K8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLFPNKEAAAGSSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVE
Gene Sequence KLFPNKEAAAGSSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVE
Gene ID - Mouse ENSMUSG00000039058
Gene ID - Rat ENSRNOG00000046947
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AK5 pAb (ATL-HPA019128 w/enhanced validation)
Datasheet Anti AK5 pAb (ATL-HPA019128 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AK5 pAb (ATL-HPA019128 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AK5 pAb (ATL-HPA019128 w/enhanced validation)
Datasheet Anti AK5 pAb (ATL-HPA019128 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AK5 pAb (ATL-HPA019128 w/enhanced validation)