Anti AK4 pAb (ATL-HPA042753 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA042753-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: AK4
Alternative Gene Name: AK3, AK3L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028527: 83%, ENSRNOG00000045738: 83%
Entrez Gene ID: 205
Uniprot ID: P27144
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLD |
Gene Sequence | KGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLD |
Gene ID - Mouse | ENSMUSG00000028527 |
Gene ID - Rat | ENSRNOG00000045738 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AK4 pAb (ATL-HPA042753 w/enhanced validation) | |
Datasheet | Anti AK4 pAb (ATL-HPA042753 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti AK4 pAb (ATL-HPA042753 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti AK4 pAb (ATL-HPA042753 w/enhanced validation) | |
Datasheet | Anti AK4 pAb (ATL-HPA042753 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti AK4 pAb (ATL-HPA042753 w/enhanced validation) |
Citations for Anti AK4 pAb (ATL-HPA042753 w/enhanced validation) – 1 Found |
Wujak, Magdalena; Veith, Christine; Wu, Cheng-Yu; Wilke, Tessa; Kanbagli, Zeki Ilker; Novoyatleva, Tatyana; Guenther, Andreas; Seeger, Werner; Grimminger, Friedrich; Sommer, Natascha; Schermuly, Ralph Theo; Weissmann, Norbert. Adenylate Kinase 4-A Key Regulator of Proliferation and Metabolic Shift in Human Pulmonary Arterial Smooth Muscle Cells via Akt and HIF-1α Signaling Pathways. International Journal Of Molecular Sciences. 2021;22(19) PubMed |