Anti AK4 pAb (ATL-HPA042753 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA042753-25

• 
• 

Protein Description: adenylate kinase 4
Gene Name: AK4
Alternative Gene Name: AK3, AK3L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028527: 83%, ENSRNOG00000045738: 83%
Entrez Gene ID: 205
Uniprot ID: P27144
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLD
• Gene Sequence: KGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLD
• Gene ID - Mouse: ENSMUSG00000028527
• Gene ID - Rat: ENSRNOG00000045738
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AK4 pAb (ATL-HPA042753 w/enhanced validation) – 1 Found

Wujak, Magdalena; Veith, Christine; Wu, Cheng-Yu; Wilke, Tessa; Kanbagli, Zeki Ilker; Novoyatleva, Tatyana; Guenther, Andreas; Seeger, Werner; Grimminger, Friedrich; Sommer, Natascha; Schermuly, Ralph Theo; Weissmann, Norbert. Adenylate Kinase 4-A Key Regulator of Proliferation and Metabolic Shift in Human Pulmonary Arterial Smooth Muscle Cells via Akt and HIF-1α Signaling Pathways. International Journal Of Molecular Sciences. 2021;22(19)