Anti AK1 pAb (ATL-HPA006456 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA006456-25

Protein Description: adenylate kinase 1
Gene Name: AK1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026817: 88%, ENSRNOG00000049056: 69%
Entrez Gene ID: 203
Uniprot ID: P00568
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGS
• Gene Sequence: EKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGS
• Gene ID - Mouse: ENSMUSG00000026817
• Gene ID - Rat: ENSRNOG00000049056
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.