Anti AIPL1 pAb (ATL-HPA026578)

Atlas Antibodies

SKU: ATL-HPA026578-25

• 
• 

Protein Description: aryl hydrocarbon receptor interacting protein-like 1
Gene Name: AIPL1
Alternative Gene Name: LCA4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040554: 39%, ENSRNOG00000007889: 39%
Entrez Gene ID: 23746
Uniprot ID: Q9NZN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AEVWNEAEAKADLQKVLELEPSMQKAVRRELRLLENRMAEKQEEERLRCRNMLSQGATQPPAEPPTEPPAQSSTEPPAEPPTAPSAELSAGPPAEPATEPPPSPGHSLQH
• Gene Sequence: AEVWNEAEAKADLQKVLELEPSMQKAVRRELRLLENRMAEKQEEERLRCRNMLSQGATQPPAEPPTEPPAQSSTEPPAEPPTAPSAELSAGPPAEPATEPPPSPGHSLQH
• Gene ID - Mouse: ENSMUSG00000040554
• Gene ID - Rat: ENSRNOG00000007889
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.