Anti AIMP2 pAb (ATL-HPA020057)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020057-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: AIMP2
Alternative Gene Name: JTV-1, JTV1, p38, PRO0992
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029610: 90%, ENSRNOG00000001044: 91%
Entrez Gene ID: 7965
Uniprot ID: Q13155
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQ |
Gene Sequence | SVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQ |
Gene ID - Mouse | ENSMUSG00000029610 |
Gene ID - Rat | ENSRNOG00000001044 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AIMP2 pAb (ATL-HPA020057) | |
Datasheet | Anti AIMP2 pAb (ATL-HPA020057) Datasheet (External Link) |
Vendor Page | Anti AIMP2 pAb (ATL-HPA020057) at Atlas Antibodies |
Documents & Links for Anti AIMP2 pAb (ATL-HPA020057) | |
Datasheet | Anti AIMP2 pAb (ATL-HPA020057) Datasheet (External Link) |
Vendor Page | Anti AIMP2 pAb (ATL-HPA020057) |