Anti AIMP2 pAb (ATL-HPA020057)

Atlas Antibodies

Catalog No.: ATL-HPA020057-25

Protein Description: aminoacyl tRNA synthetase complex-interacting multifunctional protein 2
Gene Name: AIMP2
Alternative Gene Name: JTV-1, JTV1, p38, PRO0992
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029610: 90%, ENSRNOG00000001044: 91%
Entrez Gene ID: 7965
Uniprot ID: Q13155
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQ
• Gene Sequence: SVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQ
• Gene ID - Mouse: ENSMUSG00000029610
• Gene ID - Rat: ENSRNOG00000001044
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.