Anti AIMP2 pAb (ATL-HPA019098)

Atlas Antibodies

SKU:
ATL-HPA019098-25
  • Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line A549 shows localization to cytosol.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: aminoacyl tRNA synthetase complex-interacting multifunctional protein 2
Gene Name: AIMP2
Alternative Gene Name: JTV-1, JTV1, p38, PRO0992
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029610: 84%, ENSRNOG00000001044: 86%
Entrez Gene ID: 7965
Uniprot ID: Q13155
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen APLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNAL
Gene Sequence APLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNAL
Gene ID - Mouse ENSMUSG00000029610
Gene ID - Rat ENSRNOG00000001044
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AIMP2 pAb (ATL-HPA019098)
Datasheet Anti AIMP2 pAb (ATL-HPA019098) Datasheet (External Link)
Vendor Page Anti AIMP2 pAb (ATL-HPA019098) at Atlas Antibodies

Documents & Links for Anti AIMP2 pAb (ATL-HPA019098)
Datasheet Anti AIMP2 pAb (ATL-HPA019098) Datasheet (External Link)
Vendor Page Anti AIMP2 pAb (ATL-HPA019098)