Anti AIM2 pAb (ATL-HPA040309)

Atlas Antibodies

Catalog No.:
ATL-HPA040309-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: absent in melanoma 2
Gene Name: AIM2
Alternative Gene Name: PYHIN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037860: 55%, ENSRNOG00000003480: 55%
Entrez Gene ID: 9447
Uniprot ID: O14862
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATLMIQNAGAVSAVMKTIRIFQKLNYMLLAKRLQEEKEKVDKQYKSVTK
Gene Sequence MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATLMIQNAGAVSAVMKTIRIFQKLNYMLLAKRLQEEKEKVDKQYKSVTK
Gene ID - Mouse ENSMUSG00000037860
Gene ID - Rat ENSRNOG00000003480
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AIM2 pAb (ATL-HPA040309)
Datasheet Anti AIM2 pAb (ATL-HPA040309) Datasheet (External Link)
Vendor Page Anti AIM2 pAb (ATL-HPA040309) at Atlas Antibodies

Documents & Links for Anti AIM2 pAb (ATL-HPA040309)
Datasheet Anti AIM2 pAb (ATL-HPA040309) Datasheet (External Link)
Vendor Page Anti AIM2 pAb (ATL-HPA040309)