Anti AIM2 pAb (ATL-HPA031365)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031365-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: AIM2
Alternative Gene Name: PYHIN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037860: 51%, ENSRNOG00000003480: 58%
Entrez Gene ID: 9447
Uniprot ID: O14862
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SDQKVNVPLNIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGVRNEDTMKCKEGDK |
| Gene Sequence | SDQKVNVPLNIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGVRNEDTMKCKEGDK |
| Gene ID - Mouse | ENSMUSG00000037860 |
| Gene ID - Rat | ENSRNOG00000003480 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AIM2 pAb (ATL-HPA031365) | |
| Datasheet | Anti AIM2 pAb (ATL-HPA031365) Datasheet (External Link) |
| Vendor Page | Anti AIM2 pAb (ATL-HPA031365) at Atlas Antibodies |
| Documents & Links for Anti AIM2 pAb (ATL-HPA031365) | |
| Datasheet | Anti AIM2 pAb (ATL-HPA031365) Datasheet (External Link) |
| Vendor Page | Anti AIM2 pAb (ATL-HPA031365) |
| Citations for Anti AIM2 pAb (ATL-HPA031365) – 2 Found |
| Erhart, Philipp; Cakmak, Sinan; Grond-Ginsbach, Caspar; Hakimi, Maani; Böckler, Dittmar; Dihlmann, Susanne. Inflammasome activity in leucocytes decreases with abdominal aortic aneurysm progression. International Journal Of Molecular Medicine. 2019;44(4):1299-1308. PubMed |
| Eichholz, Karsten; Bru, Thierry; Tran, Thi Thu Phuong; Fernandes, Paulo; Welles, Hugh; Mennechet, Franck J D; Manel, Nicolas; Alves, Paula; Perreau, Matthieu; Kremer, Eric J. Immune-Complexed Adenovirus Induce AIM2-Mediated Pyroptosis in Human Dendritic Cells. Plos Pathogens. 2016;12(9):e1005871. PubMed |