Anti AIM2 pAb (ATL-HPA031365)

Atlas Antibodies

Catalog No.:
ATL-HPA031365-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: absent in melanoma 2
Gene Name: AIM2
Alternative Gene Name: PYHIN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037860: 51%, ENSRNOG00000003480: 58%
Entrez Gene ID: 9447
Uniprot ID: O14862
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDQKVNVPLNIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGVRNEDTMKCKEGDK
Gene Sequence SDQKVNVPLNIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGVRNEDTMKCKEGDK
Gene ID - Mouse ENSMUSG00000037860
Gene ID - Rat ENSRNOG00000003480
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AIM2 pAb (ATL-HPA031365)
Datasheet Anti AIM2 pAb (ATL-HPA031365) Datasheet (External Link)
Vendor Page Anti AIM2 pAb (ATL-HPA031365) at Atlas Antibodies

Documents & Links for Anti AIM2 pAb (ATL-HPA031365)
Datasheet Anti AIM2 pAb (ATL-HPA031365) Datasheet (External Link)
Vendor Page Anti AIM2 pAb (ATL-HPA031365)
Citations for Anti AIM2 pAb (ATL-HPA031365) – 2 Found
Erhart, Philipp; Cakmak, Sinan; Grond-Ginsbach, Caspar; Hakimi, Maani; Böckler, Dittmar; Dihlmann, Susanne. Inflammasome activity in leucocytes decreases with abdominal aortic aneurysm progression. International Journal Of Molecular Medicine. 2019;44(4):1299-1308.  PubMed
Eichholz, Karsten; Bru, Thierry; Tran, Thi Thu Phuong; Fernandes, Paulo; Welles, Hugh; Mennechet, Franck J D; Manel, Nicolas; Alves, Paula; Perreau, Matthieu; Kremer, Eric J. Immune-Complexed Adenovirus Induce AIM2-Mediated Pyroptosis in Human Dendritic Cells. Plos Pathogens. 2016;12(9):e1005871.  PubMed