Anti AIM1L pAb (ATL-HPA029631)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029631-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: AIM1L
Alternative Gene Name: CRYBG2, FLJ38020
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012123: 86%, ENSRNOG00000057957: 82%
Entrez Gene ID: 55057
Uniprot ID: Q8N1P7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PEISLFSEEGLKGEQVKLTEALKNSQGLEKPLQVASATVSAGLWLLYPKPLFEDTPYILEPGEYPTSEAWGTSDPSVGSLKPMRL |
Gene Sequence | PEISLFSEEGLKGEQVKLTEALKNSQGLEKPLQVASATVSAGLWLLYPKPLFEDTPYILEPGEYPTSEAWGTSDPSVGSLKPMRL |
Gene ID - Mouse | ENSMUSG00000012123 |
Gene ID - Rat | ENSRNOG00000057957 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AIM1L pAb (ATL-HPA029631) | |
Datasheet | Anti AIM1L pAb (ATL-HPA029631) Datasheet (External Link) |
Vendor Page | Anti AIM1L pAb (ATL-HPA029631) at Atlas Antibodies |
Documents & Links for Anti AIM1L pAb (ATL-HPA029631) | |
Datasheet | Anti AIM1L pAb (ATL-HPA029631) Datasheet (External Link) |
Vendor Page | Anti AIM1L pAb (ATL-HPA029631) |