Anti AIM1 pAb (ATL-HPA030949)

Atlas Antibodies

Catalog No.:
ATL-HPA030949-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: absent in melanoma 1
Gene Name: AIM1
Alternative Gene Name: CRYBG1, ST4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019866: 69%, ENSRNOG00000025998: 35%
Entrez Gene ID: 202
Uniprot ID: Q9Y4K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DDMEKANHIESVIKSNLPNCANSDTDFMGLFKSSRYDPSISFSGMSLSDTMTLRGSVQNKLNPRPGKVVIYSEPDVSEKCIEVFSDIQDCSSWS
Gene Sequence DDMEKANHIESVIKSNLPNCANSDTDFMGLFKSSRYDPSISFSGMSLSDTMTLRGSVQNKLNPRPGKVVIYSEPDVSEKCIEVFSDIQDCSSWS
Gene ID - Mouse ENSMUSG00000019866
Gene ID - Rat ENSRNOG00000025998
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AIM1 pAb (ATL-HPA030949)
Datasheet Anti AIM1 pAb (ATL-HPA030949) Datasheet (External Link)
Vendor Page Anti AIM1 pAb (ATL-HPA030949) at Atlas Antibodies

Documents & Links for Anti AIM1 pAb (ATL-HPA030949)
Datasheet Anti AIM1 pAb (ATL-HPA030949) Datasheet (External Link)
Vendor Page Anti AIM1 pAb (ATL-HPA030949)