Anti AIM1 pAb (ATL-HPA030949)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030949-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: AIM1
Alternative Gene Name: CRYBG1, ST4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019866: 69%, ENSRNOG00000025998: 35%
Entrez Gene ID: 202
Uniprot ID: Q9Y4K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DDMEKANHIESVIKSNLPNCANSDTDFMGLFKSSRYDPSISFSGMSLSDTMTLRGSVQNKLNPRPGKVVIYSEPDVSEKCIEVFSDIQDCSSWS |
| Gene Sequence | DDMEKANHIESVIKSNLPNCANSDTDFMGLFKSSRYDPSISFSGMSLSDTMTLRGSVQNKLNPRPGKVVIYSEPDVSEKCIEVFSDIQDCSSWS |
| Gene ID - Mouse | ENSMUSG00000019866 |
| Gene ID - Rat | ENSRNOG00000025998 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AIM1 pAb (ATL-HPA030949) | |
| Datasheet | Anti AIM1 pAb (ATL-HPA030949) Datasheet (External Link) |
| Vendor Page | Anti AIM1 pAb (ATL-HPA030949) at Atlas Antibodies |
| Documents & Links for Anti AIM1 pAb (ATL-HPA030949) | |
| Datasheet | Anti AIM1 pAb (ATL-HPA030949) Datasheet (External Link) |
| Vendor Page | Anti AIM1 pAb (ATL-HPA030949) |