Anti AIM1 pAb (ATL-HPA030948)

Atlas Antibodies

SKU: ATL-HPA030948-25

• 
• 

Protein Description: absent in melanoma 1
Gene Name: AIM1
Alternative Gene Name: CRYBG1, ST4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019866: 80%, ENSRNOG00000058870: 26%
Entrez Gene ID: 202
Uniprot ID: Q9Y4K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ARMPNSPAPHFAMPPIHEDHLEKVFDPKVFTFGLGKKKESQPEMSPALHLMQNLDTKSKLRPKRASAEQSVLFKSLHTNTNGNSEP
• Gene Sequence: ARMPNSPAPHFAMPPIHEDHLEKVFDPKVFTFGLGKKKESQPEMSPALHLMQNLDTKSKLRPKRASAEQSVLFKSLHTNTNGNSEP
• Gene ID - Mouse: ENSMUSG00000019866
• Gene ID - Rat: ENSRNOG00000058870
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.