Anti AIM1 pAb (ATL-HPA030948)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030948-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: AIM1
Alternative Gene Name: CRYBG1, ST4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019866: 80%, ENSRNOG00000058870: 26%
Entrez Gene ID: 202
Uniprot ID: Q9Y4K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ARMPNSPAPHFAMPPIHEDHLEKVFDPKVFTFGLGKKKESQPEMSPALHLMQNLDTKSKLRPKRASAEQSVLFKSLHTNTNGNSEP |
Gene Sequence | ARMPNSPAPHFAMPPIHEDHLEKVFDPKVFTFGLGKKKESQPEMSPALHLMQNLDTKSKLRPKRASAEQSVLFKSLHTNTNGNSEP |
Gene ID - Mouse | ENSMUSG00000019866 |
Gene ID - Rat | ENSRNOG00000058870 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AIM1 pAb (ATL-HPA030948) | |
Datasheet | Anti AIM1 pAb (ATL-HPA030948) Datasheet (External Link) |
Vendor Page | Anti AIM1 pAb (ATL-HPA030948) at Atlas Antibodies |
Documents & Links for Anti AIM1 pAb (ATL-HPA030948) | |
Datasheet | Anti AIM1 pAb (ATL-HPA030948) Datasheet (External Link) |
Vendor Page | Anti AIM1 pAb (ATL-HPA030948) |