Anti AIFM1 pAb (ATL-HPA030611 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA030611-100

• 
• 

Protein Description: apoptosis-inducing factor, mitochondrion-associated, 1
Gene Name: AIFM1
Alternative Gene Name: AIF, CMTX4, NAMSD, PDCD8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036932: 100%, ENSRNOG00000006067: 100%
Entrez Gene ID: 9131
Uniprot ID: O95831
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGV
• Gene Sequence: GLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGV
• Gene ID - Mouse: ENSMUSG00000036932
• Gene ID - Rat: ENSRNOG00000006067
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AIFM1 pAb (ATL-HPA030611 w/enhanced validation) – 1 Found

Usategui-Martín, Ricardo; Puertas-Neyra, Kevin; Galindo-Cabello, Nadia; Hernández-Rodríguez, Leticia A; González-Pérez, Fernando; Rodríguez-Cabello, José Carlos; González-Sarmiento, Rogelio; Pastor, José Carlos; Fernandez-Bueno, Ivan. Retinal Neuroprotective Effect of Mesenchymal Stem Cells Secretome Through Modulation of Oxidative Stress, Autophagy, and Programmed Cell Death. Investigative Ophthalmology & Visual Science. 2022;63(4):27.