Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA020522-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: AIF1L
Alternative Gene Name: C9orf58, FLJ12783, IBA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001864: 98%, ENSRNOG00000009951: 98%
Entrez Gene ID: 83543
Uniprot ID: Q9BQI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP |
Gene Sequence | HLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP |
Gene ID - Mouse | ENSMUSG00000001864 |
Gene ID - Rat | ENSRNOG00000009951 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) | |
Datasheet | Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) | |
Datasheet | Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) |
Citations for Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) – 3 Found |
Liu, Peipei; Li, Wenhui; Hu, Yuanyuan; Jiang, Youhong. Absence of AIF1L contributes to cell migration and a poor prognosis of breast cancer. Oncotargets And Therapy. 11( 30233209):5485-5498. PubMed |
Parikh, Dippal; Riascos-Bernal, Dario F; Egaña-Gorroño, Lander; Jayakumar, Smitha; Almonte, Vanessa; Chinnasamy, Prameladevi; Sibinga, Nicholas E S. Allograft inflammatory factor-1-like is not essential for age dependent weight gain or HFD-induced obesity and glucose insensitivity. Scientific Reports. 2020;10(1):3594. PubMed |
Parikh, Dippal; Jayakumar, Smitha; Oliveira-Paula, Gustavo H; Almonte, Vanessa; Riascos-Bernal, Dario F; Sibinga, Nicholas E S. Allograft inflammatory factor-1-like is a situational regulator of leptin levels, hyperphagia, and obesity. Iscience. 2022;25(10):105058. PubMed |