Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA020522-25
  • Immunohistochemistry analysis in human kidney and skeletal muscle tissues using HPA020522 antibody. Corresponding AIF1L RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: allograft inflammatory factor 1-like
Gene Name: AIF1L
Alternative Gene Name: C9orf58, FLJ12783, IBA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001864: 98%, ENSRNOG00000009951: 98%
Entrez Gene ID: 83543
Uniprot ID: Q9BQI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP
Gene Sequence HLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP
Gene ID - Mouse ENSMUSG00000001864
Gene ID - Rat ENSRNOG00000009951
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation)
Datasheet Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation)
Datasheet Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation)



Citations for Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) – 3 Found
Liu, Peipei; Li, Wenhui; Hu, Yuanyuan; Jiang, Youhong. Absence of AIF1L contributes to cell migration and a poor prognosis of breast cancer. Oncotargets And Therapy. 11( 30233209):5485-5498.  PubMed
Parikh, Dippal; Riascos-Bernal, Dario F; Egaña-Gorroño, Lander; Jayakumar, Smitha; Almonte, Vanessa; Chinnasamy, Prameladevi; Sibinga, Nicholas E S. Allograft inflammatory factor-1-like is not essential for age dependent weight gain or HFD-induced obesity and glucose insensitivity. Scientific Reports. 2020;10(1):3594.  PubMed
Parikh, Dippal; Jayakumar, Smitha; Oliveira-Paula, Gustavo H; Almonte, Vanessa; Riascos-Bernal, Dario F; Sibinga, Nicholas E S. Allograft inflammatory factor-1-like is a situational regulator of leptin levels, hyperphagia, and obesity. Iscience. 2022;25(10):105058.  PubMed