Anti AIDA pAb (ATL-HPA027935)

Atlas Antibodies

Catalog No.:
ATL-HPA027935-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: axin interactor, dorsalization associated
Gene Name: AIDA
Alternative Gene Name: C1orf80, FLJ12806
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042901: 96%, ENSRNOG00000058805: 96%
Entrez Gene ID: 64853
Uniprot ID: Q96BJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVS
Gene Sequence EEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVS
Gene ID - Mouse ENSMUSG00000042901
Gene ID - Rat ENSRNOG00000058805
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AIDA pAb (ATL-HPA027935)
Datasheet Anti AIDA pAb (ATL-HPA027935) Datasheet (External Link)
Vendor Page Anti AIDA pAb (ATL-HPA027935) at Atlas Antibodies

Documents & Links for Anti AIDA pAb (ATL-HPA027935)
Datasheet Anti AIDA pAb (ATL-HPA027935) Datasheet (External Link)
Vendor Page Anti AIDA pAb (ATL-HPA027935)