Anti AIDA pAb (ATL-HPA027935)

Atlas Antibodies

Catalog No.: ATL-HPA027935-100

Protein Description: axin interactor, dorsalization associated
Gene Name: AIDA
Alternative Gene Name: C1orf80, FLJ12806
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042901: 96%, ENSRNOG00000058805: 96%
Entrez Gene ID: 64853
Uniprot ID: Q96BJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVS
• Gene Sequence: EEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVS
• Gene ID - Mouse: ENSMUSG00000042901
• Gene ID - Rat: ENSRNOG00000058805
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.