Anti AHSG pAb (ATL-HPA001525 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA001525-25
  • Immunohistochemical staining of human bone marrow, cerebral cortex, liver and lymph node using Anti-AHSG antibody HPA001525 (A) shows similar protein distribution across tissues to independent antibody HPA001524 (B).
  • Immunofluorescent staining of human cell line Hep G2 shows localization to the Golgi apparatus.
  • Western blot analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-AHSG antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: alpha-2-HS-glycoprotein
Gene Name: AHSG
Alternative Gene Name: A2HS, FETUA, HSGA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022868: 64%, ENSRNOG00000038370: 64%
Entrez Gene ID: 197
Uniprot ID: P02765
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALA
Gene Sequence GLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALA
Gene ID - Mouse ENSMUSG00000022868
Gene ID - Rat ENSRNOG00000038370
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AHSG pAb (ATL-HPA001525 w/enhanced validation)
Datasheet Anti AHSG pAb (ATL-HPA001525 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AHSG pAb (ATL-HPA001525 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AHSG pAb (ATL-HPA001525 w/enhanced validation)
Datasheet Anti AHSG pAb (ATL-HPA001525 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AHSG pAb (ATL-HPA001525 w/enhanced validation)



Citations for Anti AHSG pAb (ATL-HPA001525 w/enhanced validation) – 2 Found
Levin, Y; Wang, L; Schwarz, E; Koethe, D; Leweke, F M; Bahn, S. Global proteomic profiling reveals altered proteomic signature in schizophrenia serum. Molecular Psychiatry. 2010;15(11):1088-100.  PubMed
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed