Anti AHR pAb (ATL-HPA029723 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA029723-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: aryl hydrocarbon receptor
Gene Name: AHR
Alternative Gene Name: bHLHe76
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019256: 38%, ENSRNOG00000004342: 55%
Entrez Gene ID: 196
Uniprot ID: P35869
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHHPSE
Gene Sequence PQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHHPSE
Gene ID - Mouse ENSMUSG00000019256
Gene ID - Rat ENSRNOG00000004342
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AHR pAb (ATL-HPA029723 w/enhanced validation)
Datasheet Anti AHR pAb (ATL-HPA029723 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AHR pAb (ATL-HPA029723 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AHR pAb (ATL-HPA029723 w/enhanced validation)
Datasheet Anti AHR pAb (ATL-HPA029723 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AHR pAb (ATL-HPA029723 w/enhanced validation)
Citations for Anti AHR pAb (ATL-HPA029723 w/enhanced validation) – 2 Found
Wakx, Anaïs; Nedder, Margaux; Tomkiewicz-Raulet, Céline; Dalmasso, Jessica; Chissey, Audrey; Boland, Sonja; Vibert, Françoise; Degrelle, Séverine A; Fournier, Thierry; Coumoul, Xavier; Gil, Sophie; Ferecatu, Ioana. Expression, Localization, and Activity of the Aryl Hydrocarbon Receptor in the Human Placenta. International Journal Of Molecular Sciences. 2018;19(12)  PubMed
Wang, Zhongyan; Snyder, Megan; Kenison, Jessica E; Yang, Kangkang; Lara, Brian; Lydell, Emily; Bennani, Kawtar; Novikov, Olga; Federico, Anthony; Monti, Stefano; Sherr, David H. How the AHR Became Important in Cancer: The Role of Chronically Active AHR in Cancer Aggression. International Journal Of Molecular Sciences. 2020;22(1)  PubMed