Anti AHR pAb (ATL-HPA029723 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029723-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: AHR
Alternative Gene Name: bHLHe76
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019256: 38%, ENSRNOG00000004342: 55%
Entrez Gene ID: 196
Uniprot ID: P35869
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHHPSE |
| Gene Sequence | PQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHHPSE |
| Gene ID - Mouse | ENSMUSG00000019256 |
| Gene ID - Rat | ENSRNOG00000004342 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AHR pAb (ATL-HPA029723 w/enhanced validation) | |
| Datasheet | Anti AHR pAb (ATL-HPA029723 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AHR pAb (ATL-HPA029723 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AHR pAb (ATL-HPA029723 w/enhanced validation) | |
| Datasheet | Anti AHR pAb (ATL-HPA029723 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AHR pAb (ATL-HPA029723 w/enhanced validation) |
| Citations for Anti AHR pAb (ATL-HPA029723 w/enhanced validation) – 2 Found |
| Wakx, Anaïs; Nedder, Margaux; Tomkiewicz-Raulet, Céline; Dalmasso, Jessica; Chissey, Audrey; Boland, Sonja; Vibert, Françoise; Degrelle, Séverine A; Fournier, Thierry; Coumoul, Xavier; Gil, Sophie; Ferecatu, Ioana. Expression, Localization, and Activity of the Aryl Hydrocarbon Receptor in the Human Placenta. International Journal Of Molecular Sciences. 2018;19(12) PubMed |
| Wang, Zhongyan; Snyder, Megan; Kenison, Jessica E; Yang, Kangkang; Lara, Brian; Lydell, Emily; Bennani, Kawtar; Novikov, Olga; Federico, Anthony; Monti, Stefano; Sherr, David H. How the AHR Became Important in Cancer: The Role of Chronically Active AHR in Cancer Aggression. International Journal Of Molecular Sciences. 2020;22(1) PubMed |