Anti AHNAK2 pAb (ATL-HPA002940 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002940-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: AHNAK2
Alternative Gene Name: C14orf78
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072812: 66%, ENSRNOG00000028545: 63%
Entrez Gene ID: 113146
Uniprot ID: Q8IVF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DAKDSKFKMPKFKMPSFRVSAPGESIEALVDVSELKVEADMSLPSMQGDLKTTDISIQPPSAQLEVQAGQVDVKLPEGHVPEGAGLKGHLPKLQMPSFKMPEVDLKG |
Gene Sequence | DAKDSKFKMPKFKMPSFRVSAPGESIEALVDVSELKVEADMSLPSMQGDLKTTDISIQPPSAQLEVQAGQVDVKLPEGHVPEGAGLKGHLPKLQMPSFKMPEVDLKG |
Gene ID - Mouse | ENSMUSG00000072812 |
Gene ID - Rat | ENSRNOG00000028545 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AHNAK2 pAb (ATL-HPA002940 w/enhanced validation) | |
Datasheet | Anti AHNAK2 pAb (ATL-HPA002940 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti AHNAK2 pAb (ATL-HPA002940 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti AHNAK2 pAb (ATL-HPA002940 w/enhanced validation) | |
Datasheet | Anti AHNAK2 pAb (ATL-HPA002940 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti AHNAK2 pAb (ATL-HPA002940 w/enhanced validation) |
Citations for Anti AHNAK2 pAb (ATL-HPA002940 w/enhanced validation) – 5 Found |
Wang, Minglei; Li, Xuefeng; Zhang, Jin; Yang, Qiong; Chen, Wenqi; Jin, Weilin; Huang, Yi-Ran; Yang, Ru; Gao, Wei-Qiang. AHNAK2 is a Novel Prognostic Marker and Oncogenic Protein for Clear Cell Renal Cell Carcinoma. Theranostics. 7(5):1100-1113. PubMed |
Klett, Hagen; Fuellgraf, Hannah; Levit-Zerdoun, Ella; Hussung, Saskia; Kowar, Silke; Küsters, Simon; Bronsert, Peter; Werner, Martin; Wittel, Uwe; Fritsch, Ralph; Busch, Hauke; Boerries, Melanie. Identification and Validation of a Diagnostic and Prognostic Multi-Gene Biomarker Panel for Pancreatic Ductal Adenocarcinoma. Frontiers In Genetics. 9( 29675033):108. PubMed |
Fagerberg, Linn; Oksvold, Per; Skogs, Marie; Algenäs, Cajsa; Lundberg, Emma; Pontén, Fredrik; Sivertsson, Asa; Odeberg, Jacob; Klevebring, Daniel; Kampf, Caroline; Asplund, Anna; Sjöstedt, Evelina; Al-Khalili Szigyarto, Cristina; Edqvist, Per-Henrik; Olsson, Ingmarie; Rydberg, Urban; Hudson, Paul; Ottosson Takanen, Jenny; Berling, Holger; Björling, Lisa; Tegel, Hanna; Rockberg, Johan; Nilsson, Peter; Navani, Sanjay; Jirström, Karin; Mulder, Jan; Schwenk, Jochen M; Zwahlen, Martin; Hober, Sophia; Forsberg, Mattias; von Feilitzen, Kalle; Uhlén, Mathias. Contribution of antibody-based protein profiling to the human Chromosome-centric Proteome Project (C-HPP). Journal Of Proteome Research. 2013;12(6):2439-48. PubMed |
Xie, Zhenyu; Lun, Yu; Li, Xin; He, Yuzhen; Wu, Song; Wang, Shiyue; Sun, Jianjian; He, Yuchen; Zhang, Jian. Bioinformatics analysis of the clinical value and potential mechanisms of AHNAK2 in papillary thyroid carcinoma. Aging. 2020;12(18):18163-18180. PubMed |
Xu, Meng; Cheng, Anyi; Yu, Liya; Wei, Wei; Li, Jinpeng; Cai, Cheguo. AHNAK2 is a biomarker and a potential therapeutic target of adenocarcinomas. Acta Biochimica Et Biophysica Sinica. 2022;54(11):1708-1719. PubMed |