Anti AHNAK2 pAb (ATL-HPA002940 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA002940-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: AHNAK nucleoprotein 2
Gene Name: AHNAK2
Alternative Gene Name: C14orf78
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072812: 66%, ENSRNOG00000028545: 63%
Entrez Gene ID: 113146
Uniprot ID: Q8IVF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DAKDSKFKMPKFKMPSFRVSAPGESIEALVDVSELKVEADMSLPSMQGDLKTTDISIQPPSAQLEVQAGQVDVKLPEGHVPEGAGLKGHLPKLQMPSFKMPEVDLKG
Gene Sequence DAKDSKFKMPKFKMPSFRVSAPGESIEALVDVSELKVEADMSLPSMQGDLKTTDISIQPPSAQLEVQAGQVDVKLPEGHVPEGAGLKGHLPKLQMPSFKMPEVDLKG
Gene ID - Mouse ENSMUSG00000072812
Gene ID - Rat ENSRNOG00000028545
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AHNAK2 pAb (ATL-HPA002940 w/enhanced validation)
Datasheet Anti AHNAK2 pAb (ATL-HPA002940 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AHNAK2 pAb (ATL-HPA002940 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AHNAK2 pAb (ATL-HPA002940 w/enhanced validation)
Datasheet Anti AHNAK2 pAb (ATL-HPA002940 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AHNAK2 pAb (ATL-HPA002940 w/enhanced validation)
Citations for Anti AHNAK2 pAb (ATL-HPA002940 w/enhanced validation) – 5 Found
Wang, Minglei; Li, Xuefeng; Zhang, Jin; Yang, Qiong; Chen, Wenqi; Jin, Weilin; Huang, Yi-Ran; Yang, Ru; Gao, Wei-Qiang. AHNAK2 is a Novel Prognostic Marker and Oncogenic Protein for Clear Cell Renal Cell Carcinoma. Theranostics. 7(5):1100-1113.  PubMed
Klett, Hagen; Fuellgraf, Hannah; Levit-Zerdoun, Ella; Hussung, Saskia; Kowar, Silke; Küsters, Simon; Bronsert, Peter; Werner, Martin; Wittel, Uwe; Fritsch, Ralph; Busch, Hauke; Boerries, Melanie. Identification and Validation of a Diagnostic and Prognostic Multi-Gene Biomarker Panel for Pancreatic Ductal Adenocarcinoma. Frontiers In Genetics. 9( 29675033):108.  PubMed
Fagerberg, Linn; Oksvold, Per; Skogs, Marie; Algenäs, Cajsa; Lundberg, Emma; Pontén, Fredrik; Sivertsson, Asa; Odeberg, Jacob; Klevebring, Daniel; Kampf, Caroline; Asplund, Anna; Sjöstedt, Evelina; Al-Khalili Szigyarto, Cristina; Edqvist, Per-Henrik; Olsson, Ingmarie; Rydberg, Urban; Hudson, Paul; Ottosson Takanen, Jenny; Berling, Holger; Björling, Lisa; Tegel, Hanna; Rockberg, Johan; Nilsson, Peter; Navani, Sanjay; Jirström, Karin; Mulder, Jan; Schwenk, Jochen M; Zwahlen, Martin; Hober, Sophia; Forsberg, Mattias; von Feilitzen, Kalle; Uhlén, Mathias. Contribution of antibody-based protein profiling to the human Chromosome-centric Proteome Project (C-HPP). Journal Of Proteome Research. 2013;12(6):2439-48.  PubMed
Xie, Zhenyu; Lun, Yu; Li, Xin; He, Yuzhen; Wu, Song; Wang, Shiyue; Sun, Jianjian; He, Yuchen; Zhang, Jian. Bioinformatics analysis of the clinical value and potential mechanisms of AHNAK2 in papillary thyroid carcinoma. Aging. 2020;12(18):18163-18180.  PubMed
Xu, Meng; Cheng, Anyi; Yu, Liya; Wei, Wei; Li, Jinpeng; Cai, Cheguo. AHNAK2 is a biomarker and a potential therapeutic target of adenocarcinomas. Acta Biochimica Et Biophysica Sinica. 2022;54(11):1708-1719.  PubMed