Anti AHNAK pAb (ATL-HPA026643)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026643-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: AHNAK
Alternative Gene Name: MGC5395
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069833: 81%, ENSRNOG00000057569: 82%
Entrez Gene ID: 79026
Uniprot ID: Q09666
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MKGTKVKTPEMIIQKPKISMQDVDLSLGSPKLKGDIKVSAPGVQGDVKGPQVALKGSRVDIETPNLEGTLTGPRLGSPSGKTGTCRISMSEVDLNVAAPKVKGGVDVTLPRVEGKVKVPEVDVRGPKVDVSA |
| Gene Sequence | MKGTKVKTPEMIIQKPKISMQDVDLSLGSPKLKGDIKVSAPGVQGDVKGPQVALKGSRVDIETPNLEGTLTGPRLGSPSGKTGTCRISMSEVDLNVAAPKVKGGVDVTLPRVEGKVKVPEVDVRGPKVDVSA |
| Gene ID - Mouse | ENSMUSG00000069833 |
| Gene ID - Rat | ENSRNOG00000057569 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AHNAK pAb (ATL-HPA026643) | |
| Datasheet | Anti AHNAK pAb (ATL-HPA026643) Datasheet (External Link) |
| Vendor Page | Anti AHNAK pAb (ATL-HPA026643) at Atlas Antibodies |
| Documents & Links for Anti AHNAK pAb (ATL-HPA026643) | |
| Datasheet | Anti AHNAK pAb (ATL-HPA026643) Datasheet (External Link) |
| Vendor Page | Anti AHNAK pAb (ATL-HPA026643) |
| Citations for Anti AHNAK pAb (ATL-HPA026643) – 3 Found |
| Silva, Thaiomara A; Smuczek, Basílio; Valadão, Iuri C; Dzik, Luciana M; Iglesia, Rebeca P; Cruz, Mário C; Zelanis, André; de Siqueira, Adriane S; Serrano, Solange M T; Goldberg, Gary S; Jaeger, Ruy G; Freitas, Vanessa M. AHNAK enables mammary carcinoma cells to produce extracellular vesicles that increase neighboring fibroblast cell motility. Oncotarget. 2016;7(31):49998-50016. PubMed |
| Lee, Hyebin; Kim, Kwangsoo; Woo, Jongmin; Park, Joonho; Kim, Hyeyoon; Lee, Kyung Eun; Kim, Hyeyeon; Kim, Youngsoo; Moon, Kyung Chul; Kim, Ji Young; Park, In Ae; Shim, Bo Bae; Moon, Ji Hye; Han, Dohyun; Ryu, Han Suk. Quantitative Proteomic Analysis Identifies AHNAK (Neuroblast Differentiation-associated Protein AHNAK) as a Novel Candidate Biomarker for Bladder Urothelial Carcinoma Diagnosis by Liquid-based Cytology. Molecular & Cellular Proteomics : Mcp. 2018;17(9):1788-1802. PubMed |
| Wang, Linan; Branson, Owen E; Shilo, Konstantin; Hitchcock, Charles L; Freitas, Michael A. Proteomic Signatures of Thymomas. Plos One. 11(11):e0166494. PubMed |