Anti AHNAK pAb (ATL-HPA019010)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019010-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: AHNAK
Alternative Gene Name: MGC5395
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069833: 87%, ENSRNOG00000057569: 84%
Entrez Gene ID: 79026
Uniprot ID: Q09666
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LGEGHLSVKGSGGEWKGPQVSSALNLDTSKFAGGLHFSGPKVEGGVKGGQIGLQAPGLSVSGPQGHLESGSGKVTFPKMKIPKFTFSGRELVGREMGVDVHFPKAEASIQAGAGDGEWEESEVKLKKSKIKMPK |
| Gene Sequence | LGEGHLSVKGSGGEWKGPQVSSALNLDTSKFAGGLHFSGPKVEGGVKGGQIGLQAPGLSVSGPQGHLESGSGKVTFPKMKIPKFTFSGRELVGREMGVDVHFPKAEASIQAGAGDGEWEESEVKLKKSKIKMPK |
| Gene ID - Mouse | ENSMUSG00000069833 |
| Gene ID - Rat | ENSRNOG00000057569 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AHNAK pAb (ATL-HPA019010) | |
| Datasheet | Anti AHNAK pAb (ATL-HPA019010) Datasheet (External Link) |
| Vendor Page | Anti AHNAK pAb (ATL-HPA019010) at Atlas Antibodies |
| Documents & Links for Anti AHNAK pAb (ATL-HPA019010) | |
| Datasheet | Anti AHNAK pAb (ATL-HPA019010) Datasheet (External Link) |
| Vendor Page | Anti AHNAK pAb (ATL-HPA019010) |
| Citations for Anti AHNAK pAb (ATL-HPA019010) – 2 Found |
| Lee, Hyebin; Kim, Kwangsoo; Woo, Jongmin; Park, Joonho; Kim, Hyeyoon; Lee, Kyung Eun; Kim, Hyeyeon; Kim, Youngsoo; Moon, Kyung Chul; Kim, Ji Young; Park, In Ae; Shim, Bo Bae; Moon, Ji Hye; Han, Dohyun; Ryu, Han Suk. Quantitative Proteomic Analysis Identifies AHNAK (Neuroblast Differentiation-associated Protein AHNAK) as a Novel Candidate Biomarker for Bladder Urothelial Carcinoma Diagnosis by Liquid-based Cytology. Molecular & Cellular Proteomics : Mcp. 2018;17(9):1788-1802. PubMed |
| Fagerberg, Linn; Oksvold, Per; Skogs, Marie; Algenäs, Cajsa; Lundberg, Emma; Pontén, Fredrik; Sivertsson, Asa; Odeberg, Jacob; Klevebring, Daniel; Kampf, Caroline; Asplund, Anna; Sjöstedt, Evelina; Al-Khalili Szigyarto, Cristina; Edqvist, Per-Henrik; Olsson, Ingmarie; Rydberg, Urban; Hudson, Paul; Ottosson Takanen, Jenny; Berling, Holger; Björling, Lisa; Tegel, Hanna; Rockberg, Johan; Nilsson, Peter; Navani, Sanjay; Jirström, Karin; Mulder, Jan; Schwenk, Jochen M; Zwahlen, Martin; Hober, Sophia; Forsberg, Mattias; von Feilitzen, Kalle; Uhlén, Mathias. Contribution of antibody-based protein profiling to the human Chromosome-centric Proteome Project (C-HPP). Journal Of Proteome Research. 2013;12(6):2439-48. PubMed |