Anti AHI1 pAb (ATL-HPA046684)

Atlas Antibodies

Catalog No.: ATL-HPA046684-25

Protein Description: Abelson helper integration site 1
Gene Name: AHI1
Alternative Gene Name: FLJ20069, JBTS3, ORF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019986: 88%, ENSRNOG00000013969: 87%
Entrez Gene ID: 54806
Uniprot ID: Q8N157
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVAMYSDLPFKSPIRDISYHPFENMVAFCAFGQNEPILLYIYDFHVAQQEAEMFKRYNGTFPLPGIHQSQDALCTCPKLPHQGSFQIDEFVHTESSSTKMQLVKQ
• Gene Sequence: QVAMYSDLPFKSPIRDISYHPFENMVAFCAFGQNEPILLYIYDFHVAQQEAEMFKRYNGTFPLPGIHQSQDALCTCPKLPHQGSFQIDEFVHTESSSTKMQLVKQ
• Gene ID - Mouse: ENSMUSG00000019986
• Gene ID - Rat: ENSRNOG00000013969
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.