Anti AHI1 pAb (ATL-HPA046684)

Atlas Antibodies

Catalog No.:
ATL-HPA046684-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Abelson helper integration site 1
Gene Name: AHI1
Alternative Gene Name: FLJ20069, JBTS3, ORF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019986: 88%, ENSRNOG00000013969: 87%
Entrez Gene ID: 54806
Uniprot ID: Q8N157
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QVAMYSDLPFKSPIRDISYHPFENMVAFCAFGQNEPILLYIYDFHVAQQEAEMFKRYNGTFPLPGIHQSQDALCTCPKLPHQGSFQIDEFVHTESSSTKMQLVKQ
Gene Sequence QVAMYSDLPFKSPIRDISYHPFENMVAFCAFGQNEPILLYIYDFHVAQQEAEMFKRYNGTFPLPGIHQSQDALCTCPKLPHQGSFQIDEFVHTESSSTKMQLVKQ
Gene ID - Mouse ENSMUSG00000019986
Gene ID - Rat ENSRNOG00000013969
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AHI1 pAb (ATL-HPA046684)
Datasheet Anti AHI1 pAb (ATL-HPA046684) Datasheet (External Link)
Vendor Page Anti AHI1 pAb (ATL-HPA046684) at Atlas Antibodies

Documents & Links for Anti AHI1 pAb (ATL-HPA046684)
Datasheet Anti AHI1 pAb (ATL-HPA046684) Datasheet (External Link)
Vendor Page Anti AHI1 pAb (ATL-HPA046684)