Anti AHDC1 pAb (ATL-HPA028691)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028691-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: AHDC1
Alternative Gene Name: DJ159A19.3, RP1-159A19.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037692: 96%, ENSRNOG00000042855: 96%
Entrez Gene ID: 27245
Uniprot ID: Q5TGY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SSLSSLEKLMMDWNEASSAPGYNWNQSVLFQSSSKPGRGRRKKVDLFEASHLGFPTSASAAASGYPSKRST |
| Gene Sequence | SSLSSLEKLMMDWNEASSAPGYNWNQSVLFQSSSKPGRGRRKKVDLFEASHLGFPTSASAAASGYPSKRST |
| Gene ID - Mouse | ENSMUSG00000037692 |
| Gene ID - Rat | ENSRNOG00000042855 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AHDC1 pAb (ATL-HPA028691) | |
| Datasheet | Anti AHDC1 pAb (ATL-HPA028691) Datasheet (External Link) |
| Vendor Page | Anti AHDC1 pAb (ATL-HPA028691) at Atlas Antibodies |
| Documents & Links for Anti AHDC1 pAb (ATL-HPA028691) | |
| Datasheet | Anti AHDC1 pAb (ATL-HPA028691) Datasheet (External Link) |
| Vendor Page | Anti AHDC1 pAb (ATL-HPA028691) |