Anti AHDC1 pAb (ATL-HPA028691)

Atlas Antibodies

Catalog No.:
ATL-HPA028691-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: AT hook, DNA binding motif, containing 1
Gene Name: AHDC1
Alternative Gene Name: DJ159A19.3, RP1-159A19.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037692: 96%, ENSRNOG00000042855: 96%
Entrez Gene ID: 27245
Uniprot ID: Q5TGY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSLSSLEKLMMDWNEASSAPGYNWNQSVLFQSSSKPGRGRRKKVDLFEASHLGFPTSASAAASGYPSKRST
Gene Sequence SSLSSLEKLMMDWNEASSAPGYNWNQSVLFQSSSKPGRGRRKKVDLFEASHLGFPTSASAAASGYPSKRST
Gene ID - Mouse ENSMUSG00000037692
Gene ID - Rat ENSRNOG00000042855
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AHDC1 pAb (ATL-HPA028691)
Datasheet Anti AHDC1 pAb (ATL-HPA028691) Datasheet (External Link)
Vendor Page Anti AHDC1 pAb (ATL-HPA028691) at Atlas Antibodies

Documents & Links for Anti AHDC1 pAb (ATL-HPA028691)
Datasheet Anti AHDC1 pAb (ATL-HPA028691) Datasheet (External Link)
Vendor Page Anti AHDC1 pAb (ATL-HPA028691)