Anti AHDC1 pAb (ATL-HPA028691)

Atlas Antibodies

Catalog No.: ATL-HPA028691-25

Protein Description: AT hook, DNA binding motif, containing 1
Gene Name: AHDC1
Alternative Gene Name: DJ159A19.3, RP1-159A19.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037692: 96%, ENSRNOG00000042855: 96%
Entrez Gene ID: 27245
Uniprot ID: Q5TGY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSLSSLEKLMMDWNEASSAPGYNWNQSVLFQSSSKPGRGRRKKVDLFEASHLGFPTSASAAASGYPSKRST
• Gene Sequence: SSLSSLEKLMMDWNEASSAPGYNWNQSVLFQSSSKPGRGRRKKVDLFEASHLGFPTSASAAASGYPSKRST
• Gene ID - Mouse: ENSMUSG00000037692
• Gene ID - Rat: ENSRNOG00000042855
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.