Anti AHDC1 pAb (ATL-HPA028685)

Atlas Antibodies

SKU:
ATL-HPA028685-25
  • Immunofluorescent staining of human cell line REH shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: AT-hook DNA binding motif containing 1
Gene Name: AHDC1
Alternative Gene Name: DJ159A19.3, RP1-159A19.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037692: 91%, ENSRNOG00000042855: 90%
Entrez Gene ID: 27245
Uniprot ID: Q5TGY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RPPVLAKGDDPLPPRAARPVSQARCPTPVGDGSSSRRCWDNGRVNLRPVVQLIDIMKDLTRLSQDLQHSGVHLDCGGLRLSRPPAPPPGDLQYSFFS
Gene Sequence RPPVLAKGDDPLPPRAARPVSQARCPTPVGDGSSSRRCWDNGRVNLRPVVQLIDIMKDLTRLSQDLQHSGVHLDCGGLRLSRPPAPPPGDLQYSFFS
Gene ID - Mouse ENSMUSG00000037692
Gene ID - Rat ENSRNOG00000042855
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AHDC1 pAb (ATL-HPA028685)
Datasheet Anti AHDC1 pAb (ATL-HPA028685) Datasheet (External Link)
Vendor Page Anti AHDC1 pAb (ATL-HPA028685) at Atlas Antibodies

Documents & Links for Anti AHDC1 pAb (ATL-HPA028685)
Datasheet Anti AHDC1 pAb (ATL-HPA028685) Datasheet (External Link)
Vendor Page Anti AHDC1 pAb (ATL-HPA028685)