Anti AHCYL2 pAb (ATL-HPA053128 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA053128-25

• 
• 
• 

Protein Description: adenosylhomocysteinase-like 2
Gene Name: AHCYL2
Alternative Gene Name: KIAA0828
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029772: 100%, ENSRNOG00000039300: 98%
Entrez Gene ID: 23382
Uniprot ID: Q96HN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEAPRTVKKQIQFADQKQEFNKRPTKI
• Gene Sequence: GKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEAPRTVKKQIQFADQKQEFNKRPTKI
• Gene ID - Mouse: ENSMUSG00000029772
• Gene ID - Rat: ENSRNOG00000039300
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.