Anti AHCYL1 pAb (ATL-HPA042589 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA042589-100

• 
• 
• 

Protein Description: adenosylhomocysteinase-like 1
Gene Name: AHCYL1
Alternative Gene Name: IRBIT, PPP1R78, XPVKONA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027893: 100%, ENSRNOG00000061904: 30%
Entrez Gene ID: 10768
Uniprot ID: O43865
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTK
• Gene Sequence: MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTK
• Gene ID - Mouse: ENSMUSG00000027893
• Gene ID - Rat: ENSRNOG00000061904
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.