Anti AHCY pAb (ATL-HPA044675 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA044675-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: AHCY
Alternative Gene Name: SAHH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048087: 96%, ENSRNOG00000017777: 96%
Entrez Gene ID: 191
Uniprot ID: P23526
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHY |
| Gene Sequence | HPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHY |
| Gene ID - Mouse | ENSMUSG00000048087 |
| Gene ID - Rat | ENSRNOG00000017777 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AHCY pAb (ATL-HPA044675 w/enhanced validation) | |
| Datasheet | Anti AHCY pAb (ATL-HPA044675 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AHCY pAb (ATL-HPA044675 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AHCY pAb (ATL-HPA044675 w/enhanced validation) | |
| Datasheet | Anti AHCY pAb (ATL-HPA044675 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AHCY pAb (ATL-HPA044675 w/enhanced validation) |
| Citations for Anti AHCY pAb (ATL-HPA044675 w/enhanced validation) – 1 Found |
| Danielsson, Frida; Wiking, Mikaela; Mahdessian, Diana; Skogs, Marie; Ait Blal, Hammou; Hjelmare, Martin; Stadler, Charlotte; Uhlén, Mathias; Lundberg, Emma. RNA deep sequencing as a tool for selection of cell lines for systematic subcellular localization of all human proteins. Journal Of Proteome Research. 2013;12(1):299-307. PubMed |