Anti AHCY pAb (ATL-HPA044675 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA044675-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: adenosylhomocysteinase
Gene Name: AHCY
Alternative Gene Name: SAHH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048087: 96%, ENSRNOG00000017777: 96%
Entrez Gene ID: 191
Uniprot ID: P23526
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHY
Gene Sequence HPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHY
Gene ID - Mouse ENSMUSG00000048087
Gene ID - Rat ENSRNOG00000017777
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AHCY pAb (ATL-HPA044675 w/enhanced validation)
Datasheet Anti AHCY pAb (ATL-HPA044675 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AHCY pAb (ATL-HPA044675 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AHCY pAb (ATL-HPA044675 w/enhanced validation)
Datasheet Anti AHCY pAb (ATL-HPA044675 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AHCY pAb (ATL-HPA044675 w/enhanced validation)
Citations for Anti AHCY pAb (ATL-HPA044675 w/enhanced validation) – 1 Found
Danielsson, Frida; Wiking, Mikaela; Mahdessian, Diana; Skogs, Marie; Ait Blal, Hammou; Hjelmare, Martin; Stadler, Charlotte; Uhlén, Mathias; Lundberg, Emma. RNA deep sequencing as a tool for selection of cell lines for systematic subcellular localization of all human proteins. Journal Of Proteome Research. 2013;12(1):299-307.  PubMed