Anti AHCY pAb (ATL-HPA041225)

Atlas Antibodies

SKU:
ATL-HPA041225-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.
  • Western blot analysis in human cell line CACO-2.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: adenosylhomocysteinase
Gene Name: AHCY
Alternative Gene Name: SAHH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048087: 97%, ENSRNOG00000017777: 95%
Entrez Gene ID: 191
Uniprot ID: P23526
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLA
Gene Sequence MEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLA
Gene ID - Mouse ENSMUSG00000048087
Gene ID - Rat ENSRNOG00000017777
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AHCY pAb (ATL-HPA041225)
Datasheet Anti AHCY pAb (ATL-HPA041225) Datasheet (External Link)
Vendor Page Anti AHCY pAb (ATL-HPA041225) at Atlas Antibodies

Documents & Links for Anti AHCY pAb (ATL-HPA041225)
Datasheet Anti AHCY pAb (ATL-HPA041225) Datasheet (External Link)
Vendor Page Anti AHCY pAb (ATL-HPA041225)