Anti AGXT2 pAb (ATL-HPA037382 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA037382-25

• 

Protein Description: alanine--glyoxylate aminotransferase 2
Gene Name: AGXT2
Alternative Gene Name: AGT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000089678: 82%, ENSRNOG00000017821: 85%
Entrez Gene ID: 64902
Uniprot ID: Q9BYV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DVRGKGLMIGIEMVQDKISCRPLPREEVNQIHEDCKHMGLLVGRGSIFSQTFRIAPSMCITKPEVDFAVEVFRSALTQHMERRAK
• Gene Sequence: DVRGKGLMIGIEMVQDKISCRPLPREEVNQIHEDCKHMGLLVGRGSIFSQTFRIAPSMCITKPEVDFAVEVFRSALTQHMERRAK
• Gene ID - Mouse: ENSMUSG00000089678
• Gene ID - Rat: ENSRNOG00000017821
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AGXT2 pAb (ATL-HPA037382 w/enhanced validation) – 4 Found

Kittel, Anja; Müller, Fabian; König, Jörg; Mieth, Maren; Sticht, Heinrich; Zolk, Oliver; Kralj, Ana; Heinrich, Markus R; Fromm, Martin F; Maas, Renke. Alanine-glyoxylate aminotransferase 2 (AGXT2) polymorphisms have considerable impact on methylarginine and β-aminoisobutyrate metabolism in healthy volunteers. Plos One. 9(2):e88544. 

Rodionov, Roman N; Oppici, Elisa; Martens-Lobenhoffer, Jens; Jarzebska, Natalia; Brilloff, Silke; Burdin, Dmitrii; Demyanov, Anton; Kolouschek, Anne; Leiper, James; Maas, Renke; Cellini, Barbara; Weiss, Norbert; Bode-Böger, Stefanie M. A Novel Pathway for Metabolism of the Cardiovascular Risk Factor Homoarginine by alanine:glyoxylate aminotransferase 2. Scientific Reports. 2016;6( 27752063):35277. 

Cai, Fei-Fei; Song, Ya-Nan; Lu, Yi-Yu; Zhang, Yongyu; Hu, Yi-Yang; Su, Shi-Bing. Analysis of plasma metabolic profile, characteristics and enzymes in the progression from chronic hepatitis B to hepatocellular carcinoma. Aging. 2020;12(14):14949-14965. 

Wei, Jinshuang; Zhang, Junlin; Wei, Junyu; Hu, Miaoyue; Chen, Xiuqi; Qin, Xuankai; Chen, Jie; Lei, Fengying; Qin, Yuanhan. Identification of AGXT2, SHMT1, and ACO2 as important biomarkers of acute kidney injury by WGCNA. Plos One. 18(2):e0281439.