Anti AGTRAP pAb (ATL-HPA044120 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA044120-25
  • Immunohistochemistry analysis in human epididymis and skeletal muscle tissues using HPA044120 antibody. Corresponding AGTRAP RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows positivity in vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: angiotensin II receptor-associated protein
Gene Name: AGTRAP
Alternative Gene Name: ATRAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029007: 60%, ENSRNOG00000008619: 61%
Entrez Gene ID: 57085
Uniprot ID: Q6RW13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YHMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDARGY
Gene Sequence YHMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDARGY
Gene ID - Mouse ENSMUSG00000029007
Gene ID - Rat ENSRNOG00000008619
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti AGTRAP pAb (ATL-HPA044120 w/enhanced validation)
Datasheet Anti AGTRAP pAb (ATL-HPA044120 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AGTRAP pAb (ATL-HPA044120 w/enhanced validation)