Anti AGTPBP1 pAb (ATL-HPA057208)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057208-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: AGTPBP1
Alternative Gene Name: CCP1, KIAA1035, Nna1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021557: 79%, ENSRNOG00000018651: 75%
Entrez Gene ID: 23287
Uniprot ID: Q9UPW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ALDRITLQNIPSQTAPGFTAEMKKDCSLPLTVLTCAKACPHMATCGNVLFEGRTVQLGKLCCTGVETEDDEDTESNSSVEQASVEVPDGPTLHDPDLY |
| Gene Sequence | ALDRITLQNIPSQTAPGFTAEMKKDCSLPLTVLTCAKACPHMATCGNVLFEGRTVQLGKLCCTGVETEDDEDTESNSSVEQASVEVPDGPTLHDPDLY |
| Gene ID - Mouse | ENSMUSG00000021557 |
| Gene ID - Rat | ENSRNOG00000018651 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AGTPBP1 pAb (ATL-HPA057208) | |
| Datasheet | Anti AGTPBP1 pAb (ATL-HPA057208) Datasheet (External Link) |
| Vendor Page | Anti AGTPBP1 pAb (ATL-HPA057208) at Atlas Antibodies |
| Documents & Links for Anti AGTPBP1 pAb (ATL-HPA057208) | |
| Datasheet | Anti AGTPBP1 pAb (ATL-HPA057208) Datasheet (External Link) |
| Vendor Page | Anti AGTPBP1 pAb (ATL-HPA057208) |
| Citations for Anti AGTPBP1 pAb (ATL-HPA057208) – 1 Found |
| Kwak, Hee Jeong; Gil, Minchan; Chae, Hee Sung; Seok, Jaekwon; Soundrarajan, Nagasundarapandian; Saha, Subbroto Kumar; Kim, Aram; Park, Kyoung Sik; Park, Chankyu; Cho, Ssang-Goo. Expression of ATP/GTP Binding Protein 1 Has Prognostic Value for the Clinical Outcomes in Non-Small Cell Lung Carcinoma. Journal Of Personalized Medicine. 2020;10(4) PubMed |