Anti AGTPBP1 pAb (ATL-HPA057208)

Atlas Antibodies

Catalog No.:
ATL-HPA057208-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ATP/GTP binding protein 1
Gene Name: AGTPBP1
Alternative Gene Name: CCP1, KIAA1035, Nna1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021557: 79%, ENSRNOG00000018651: 75%
Entrez Gene ID: 23287
Uniprot ID: Q9UPW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALDRITLQNIPSQTAPGFTAEMKKDCSLPLTVLTCAKACPHMATCGNVLFEGRTVQLGKLCCTGVETEDDEDTESNSSVEQASVEVPDGPTLHDPDLY
Gene Sequence ALDRITLQNIPSQTAPGFTAEMKKDCSLPLTVLTCAKACPHMATCGNVLFEGRTVQLGKLCCTGVETEDDEDTESNSSVEQASVEVPDGPTLHDPDLY
Gene ID - Mouse ENSMUSG00000021557
Gene ID - Rat ENSRNOG00000018651
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AGTPBP1 pAb (ATL-HPA057208)
Datasheet Anti AGTPBP1 pAb (ATL-HPA057208) Datasheet (External Link)
Vendor Page Anti AGTPBP1 pAb (ATL-HPA057208) at Atlas Antibodies

Documents & Links for Anti AGTPBP1 pAb (ATL-HPA057208)
Datasheet Anti AGTPBP1 pAb (ATL-HPA057208) Datasheet (External Link)
Vendor Page Anti AGTPBP1 pAb (ATL-HPA057208)
Citations for Anti AGTPBP1 pAb (ATL-HPA057208) – 1 Found
Kwak, Hee Jeong; Gil, Minchan; Chae, Hee Sung; Seok, Jaekwon; Soundrarajan, Nagasundarapandian; Saha, Subbroto Kumar; Kim, Aram; Park, Kyoung Sik; Park, Chankyu; Cho, Ssang-Goo. Expression of ATP/GTP Binding Protein 1 Has Prognostic Value for the Clinical Outcomes in Non-Small Cell Lung Carcinoma. Journal Of Personalized Medicine. 2020;10(4)  PubMed