Anti AGT pAb (ATL-HPA001557 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA001557-25
  • Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and AGT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400005).
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: angiotensinogen (serpin peptidase inhibitor, clade A, member 8)
Gene Name: AGT
Alternative Gene Name: SERPINA8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031980: 62%, ENSRNOG00000018445: 67%
Entrez Gene ID: 183
Uniprot ID: P01019
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQG
Gene Sequence PKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQG
Gene ID - Mouse ENSMUSG00000031980
Gene ID - Rat ENSRNOG00000018445
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AGT pAb (ATL-HPA001557 w/enhanced validation)
Datasheet Anti AGT pAb (ATL-HPA001557 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AGT pAb (ATL-HPA001557 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AGT pAb (ATL-HPA001557 w/enhanced validation)
Datasheet Anti AGT pAb (ATL-HPA001557 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AGT pAb (ATL-HPA001557 w/enhanced validation)



Citations for Anti AGT pAb (ATL-HPA001557 w/enhanced validation) – 2 Found
Bachmann, Julie; Burté, Florence; Pramana, Setia; Conte, Ianina; Brown, Biobele J; Orimadegun, Adebola E; Ajetunmobi, Wasiu A; Afolabi, Nathaniel K; Akinkunmi, Francis; Omokhodion, Samuel; Akinbami, Felix O; Shokunbi, Wuraola A; Kampf, Caroline; Pawitan, Yudi; Uhlén, Mathias; Sodeinde, Olugbemiro; Schwenk, Jochen M; Wahlgren, Mats; Fernandez-Reyes, Delmiro; Nilsson, Peter. Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. Plos Pathogens. 2014;10(4):e1004038.  PubMed
Dodig-Crnković, Tea; Hong, Mun-Gwan; Thomas, Cecilia Engel; Häussler, Ragna S; Bendes, Annika; Dale, Matilda; Edfors, Fredrik; Forsström, Björn; Magnusson, Patrik K E; Schuppe-Koistinen, Ina; Odeberg, Jacob; Fagerberg, Linn; Gummesson, Anders; Bergström, Göran; Uhlén, Mathias; Schwenk, Jochen M. Facets of individual-specific health signatures determined from longitudinal plasma proteome profiling. Ebiomedicine. 2020;57( 32629387):102854.  PubMed