Anti AGRP pAb (ATL-HPA041017)

Atlas Antibodies

Catalog No.: ATL-HPA041017-25

Protein Description: agouti related neuropeptide
Gene Name: AGRP
Alternative Gene Name: Agrt, ART, ASIP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005705: 86%, ENSRNOG00000039001: 79%
Entrez Gene ID: 181
Uniprot ID: O00253
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAM
• Gene Sequence: PLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAM
• Gene ID - Mouse: ENSMUSG00000005705
• Gene ID - Rat: ENSRNOG00000039001
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.