Anti AGRP pAb (ATL-HPA041017)

Atlas Antibodies

SKU:
ATL-HPA041017-25
  • Immunohistochemical staining of human adrenal gland shows moderate cytoplasmic and membranous positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: agouti related neuropeptide
Gene Name: AGRP
Alternative Gene Name: Agrt, ART, ASIP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005705: 86%, ENSRNOG00000039001: 79%
Entrez Gene ID: 181
Uniprot ID: O00253
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAM
Gene Sequence PLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAM
Gene ID - Mouse ENSMUSG00000005705
Gene ID - Rat ENSRNOG00000039001
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AGRP pAb (ATL-HPA041017)
Datasheet Anti AGRP pAb (ATL-HPA041017) Datasheet (External Link)
Vendor Page Anti AGRP pAb (ATL-HPA041017) at Atlas Antibodies

Documents & Links for Anti AGRP pAb (ATL-HPA041017)
Datasheet Anti AGRP pAb (ATL-HPA041017) Datasheet (External Link)
Vendor Page Anti AGRP pAb (ATL-HPA041017)