Anti AGR2 pAb (ATL-HPA007912 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA007912-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: anterior gradient 2
Gene Name: AGR2
Alternative Gene Name: AG2, HAG-2, PDIA17, XAG-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020581: 94%, ENSRNOG00000005023: 94%
Entrez Gene ID: 10551
Uniprot ID: O95994
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGR
Gene Sequence RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGR
Gene ID - Mouse ENSMUSG00000020581
Gene ID - Rat ENSRNOG00000005023
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AGR2 pAb (ATL-HPA007912 w/enhanced validation)
Datasheet Anti AGR2 pAb (ATL-HPA007912 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AGR2 pAb (ATL-HPA007912 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AGR2 pAb (ATL-HPA007912 w/enhanced validation)
Datasheet Anti AGR2 pAb (ATL-HPA007912 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AGR2 pAb (ATL-HPA007912 w/enhanced validation)
Citations for Anti AGR2 pAb (ATL-HPA007912 w/enhanced validation) – 6 Found
Hrstka, Roman; Bouchalova, Pavla; Michalova, Eva; Matoulkova, Eva; Muller, Petr; Coates, Philip J; Vojtesek, Borivoj. AGR2 oncoprotein inhibits p38 MAPK and p53 activation through a DUSP10-mediated regulatory pathway. Molecular Oncology. 2016;10(5):652-62.  PubMed
Ferreira, Rute M M; Sancho, Rocio; Messal, Hendrik A; Nye, Emma; Spencer-Dene, Bradley; Stone, Richard K; Stamp, Gordon; Rosewell, Ian; Quaglia, Alberto; Behrens, Axel. Duct- and Acinar-Derived Pancreatic Ductal Adenocarcinomas Show Distinct Tumor Progression and Marker Expression. Cell Reports. 2017;21(4):966-978.  PubMed
Rodríguez-Blanco, Giovanny; Zeneyedpour, Lona; Duijvesz, Diederick; Hoogland, A Marije; Verhoef, Esther I; Kweldam, Charlotte F; Burgers, Peter C; Smitt, Peter Sillevis; Bangma, Chris H; Jenster, Guido; van Leenders, Geert J L H; Dekker, Lennard J M; Luider, Theo M. Tissue proteomics outlines AGR2 AND LOX5 as markers for biochemical recurrence of prostate cancer. Oncotarget. 2018;9(92):36444-36456.  PubMed
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed
Hrstka, Roman; Brychtova, Veronika; Fabian, Pavel; Vojtesek, Borivoj; Svoboda, Marek. AGR2 predicts tamoxifen resistance in postmenopausal breast cancer patients. Disease Markers. 35(4):207-12.  PubMed
Buczacki, Simon J A; Popova, Semiramis; Biggs, Emma; Koukorava, Chrysa; Buzzelli, Jon; Vermeulen, Louis; Hazelwood, Lee; Francies, Hayley; Garnett, Mathew J; Winton, Douglas J. Itraconazole targets cell cycle heterogeneity in colorectal cancer. The Journal Of Experimental Medicine. 2018;215(7):1891-1912.  PubMed