Anti AGR2 pAb (ATL-HPA007912 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007912-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: AGR2
Alternative Gene Name: AG2, HAG-2, PDIA17, XAG-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020581: 94%, ENSRNOG00000005023: 94%
Entrez Gene ID: 10551
Uniprot ID: O95994
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGR |
| Gene Sequence | RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGR |
| Gene ID - Mouse | ENSMUSG00000020581 |
| Gene ID - Rat | ENSRNOG00000005023 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AGR2 pAb (ATL-HPA007912 w/enhanced validation) | |
| Datasheet | Anti AGR2 pAb (ATL-HPA007912 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AGR2 pAb (ATL-HPA007912 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AGR2 pAb (ATL-HPA007912 w/enhanced validation) | |
| Datasheet | Anti AGR2 pAb (ATL-HPA007912 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AGR2 pAb (ATL-HPA007912 w/enhanced validation) |
| Citations for Anti AGR2 pAb (ATL-HPA007912 w/enhanced validation) – 6 Found |
| Hrstka, Roman; Bouchalova, Pavla; Michalova, Eva; Matoulkova, Eva; Muller, Petr; Coates, Philip J; Vojtesek, Borivoj. AGR2 oncoprotein inhibits p38 MAPK and p53 activation through a DUSP10-mediated regulatory pathway. Molecular Oncology. 2016;10(5):652-62. PubMed |
| Ferreira, Rute M M; Sancho, Rocio; Messal, Hendrik A; Nye, Emma; Spencer-Dene, Bradley; Stone, Richard K; Stamp, Gordon; Rosewell, Ian; Quaglia, Alberto; Behrens, Axel. Duct- and Acinar-Derived Pancreatic Ductal Adenocarcinomas Show Distinct Tumor Progression and Marker Expression. Cell Reports. 2017;21(4):966-978. PubMed |
| Rodríguez-Blanco, Giovanny; Zeneyedpour, Lona; Duijvesz, Diederick; Hoogland, A Marije; Verhoef, Esther I; Kweldam, Charlotte F; Burgers, Peter C; Smitt, Peter Sillevis; Bangma, Chris H; Jenster, Guido; van Leenders, Geert J L H; Dekker, Lennard J M; Luider, Theo M. Tissue proteomics outlines AGR2 AND LOX5 as markers for biochemical recurrence of prostate cancer. Oncotarget. 2018;9(92):36444-36456. PubMed |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
| Hrstka, Roman; Brychtova, Veronika; Fabian, Pavel; Vojtesek, Borivoj; Svoboda, Marek. AGR2 predicts tamoxifen resistance in postmenopausal breast cancer patients. Disease Markers. 35(4):207-12. PubMed |
| Buczacki, Simon J A; Popova, Semiramis; Biggs, Emma; Koukorava, Chrysa; Buzzelli, Jon; Vermeulen, Louis; Hazelwood, Lee; Francies, Hayley; Garnett, Mathew J; Winton, Douglas J. Itraconazole targets cell cycle heterogeneity in colorectal cancer. The Journal Of Experimental Medicine. 2018;215(7):1891-1912. PubMed |