Anti AGPS pAb (ATL-HPA030211)

Atlas Antibodies

SKU:
ATL-HPA030211-25
  • Immunohistochemical staining of human testis shows moderate granular cytoplasmic positivity in spermatogonia.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoli & peroxisomes.
  • Western blot analysis in human cell line U-2 OS.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: alkylglycerone phosphate synthase
Gene Name: AGPS
Alternative Gene Name: ADAP-S, ADAS, ADHAPS, ADPS, ALDHPSY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042410: 95%, ENSRNOG00000001547: 96%
Entrez Gene ID: 8540
Uniprot ID: O00116
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KERITRECKEKGVQFAPFSTCRVTQTYDAGACIYFYFAFNYRGISDPLTVFEQTEAAAREEILANGGSLSHHHGVGKLRKQWLKESISDVGFGMLKS
Gene Sequence KERITRECKEKGVQFAPFSTCRVTQTYDAGACIYFYFAFNYRGISDPLTVFEQTEAAAREEILANGGSLSHHHGVGKLRKQWLKESISDVGFGMLKS
Gene ID - Mouse ENSMUSG00000042410
Gene ID - Rat ENSRNOG00000001547
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AGPS pAb (ATL-HPA030211)
Datasheet Anti AGPS pAb (ATL-HPA030211) Datasheet (External Link)
Vendor Page Anti AGPS pAb (ATL-HPA030211) at Atlas Antibodies

Documents & Links for Anti AGPS pAb (ATL-HPA030211)
Datasheet Anti AGPS pAb (ATL-HPA030211) Datasheet (External Link)
Vendor Page Anti AGPS pAb (ATL-HPA030211)