Anti AGPS pAb (ATL-HPA030209)

Atlas Antibodies

Catalog No.:
ATL-HPA030209-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: alkylglycerone phosphate synthase
Gene Name: AGPS
Alternative Gene Name: ADAP-S, ADAS, ADHAPS, ADPS, ALDHPSY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042410: 80%, ENSRNOG00000001547: 81%
Entrez Gene ID: 8540
Uniprot ID: O00116
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QIELTGKRYPLSGMGLPTFKEWIQNTLGVNVEHKTTSKASLNPSDTPPSVVNEDFLHDLKETNISYSQEADDRVFRAHGHCLH
Gene Sequence QIELTGKRYPLSGMGLPTFKEWIQNTLGVNVEHKTTSKASLNPSDTPPSVVNEDFLHDLKETNISYSQEADDRVFRAHGHCLH
Gene ID - Mouse ENSMUSG00000042410
Gene ID - Rat ENSRNOG00000001547
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AGPS pAb (ATL-HPA030209)
Datasheet Anti AGPS pAb (ATL-HPA030209) Datasheet (External Link)
Vendor Page Anti AGPS pAb (ATL-HPA030209) at Atlas Antibodies

Documents & Links for Anti AGPS pAb (ATL-HPA030209)
Datasheet Anti AGPS pAb (ATL-HPA030209) Datasheet (External Link)
Vendor Page Anti AGPS pAb (ATL-HPA030209)
Citations for Anti AGPS pAb (ATL-HPA030209) – 2 Found
Gan, Esther Shuyi; Cheong, Wei Fun; Chan, Kuan Rong; Ong, Eugenia Ziying; Chai, Xiaoran; Tan, Hwee Cheng; Ghosh, Sujoy; Wenk, Markus R; Ooi, Eng Eong. Hypoxia enhances antibody-dependent dengue virus infection. The Embo Journal. 2017;36(10):1348-1363.  PubMed
Bestard-Escalas, Joan; Maimó-Barceló, Albert; Lopez, Daniel H; Reigada, Rebeca; Guardiola-Serrano, Francisca; Ramos-Vivas, José; Hornemann, Thorsten; Okazaki, Toshiro; Barceló-Coblijn, Gwendolyn. Common and Differential Traits of the Membrane Lipidome of Colon Cancer Cell Lines and their Secreted Vesicles: Impact on Studies Using Cell Lines. Cancers. 2020;12(5)  PubMed