Anti AGPAT2 pAb (ATL-HPA019544)

Atlas Antibodies

Catalog No.:
ATL-HPA019544-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: 1-acylglycerol-3-phosphate O-acyltransferase 2
Gene Name: AGPAT2
Alternative Gene Name: BSCL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026922: 63%, ENSRNOG00000019466: 63%
Entrez Gene ID: 10555
Uniprot ID: O15120
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSG
Gene Sequence YNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSG
Gene ID - Mouse ENSMUSG00000026922
Gene ID - Rat ENSRNOG00000019466
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AGPAT2 pAb (ATL-HPA019544)
Datasheet Anti AGPAT2 pAb (ATL-HPA019544) Datasheet (External Link)
Vendor Page Anti AGPAT2 pAb (ATL-HPA019544) at Atlas Antibodies

Documents & Links for Anti AGPAT2 pAb (ATL-HPA019544)
Datasheet Anti AGPAT2 pAb (ATL-HPA019544) Datasheet (External Link)
Vendor Page Anti AGPAT2 pAb (ATL-HPA019544)