Anti AGPAT1 pAb (ATL-HPA073355)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073355-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: AGPAT1
Alternative Gene Name: LPAAT-alpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034254: 89%, ENSRNOG00000000437: 93%
Entrez Gene ID: 10554
Uniprot ID: Q99943
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPG |
| Gene Sequence | GQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPG |
| Gene ID - Mouse | ENSMUSG00000034254 |
| Gene ID - Rat | ENSRNOG00000000437 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AGPAT1 pAb (ATL-HPA073355) | |
| Datasheet | Anti AGPAT1 pAb (ATL-HPA073355) Datasheet (External Link) |
| Vendor Page | Anti AGPAT1 pAb (ATL-HPA073355) at Atlas Antibodies |
| Documents & Links for Anti AGPAT1 pAb (ATL-HPA073355) | |
| Datasheet | Anti AGPAT1 pAb (ATL-HPA073355) Datasheet (External Link) |
| Vendor Page | Anti AGPAT1 pAb (ATL-HPA073355) |
| Citations for Anti AGPAT1 pAb (ATL-HPA073355) – 1 Found |
| Vessby, Johan; Wisniewski, Jacek R; Lindskog, Cecilia; Eriksson, Niclas; Gabrysch, Katja; Zettl, Katharina; Wanders, Alkwin; Carlson, Marie; Rorsman, Fredrik; Åberg, Mikael. AGPAT1 as a Novel Colonic Biomarker for Discriminating Between Ulcerative Colitis With and Without Primary Sclerosing Cholangitis. Clinical And Translational Gastroenterology. 2022;13(5):e00486. PubMed |