Anti AGPAT1 pAb (ATL-HPA048478)

Atlas Antibodies

SKU:
ATL-HPA048478-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum & rods & rings.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: 1-acylglycerol-3-phosphate O-acyltransferase 1
Gene Name: AGPAT1
Alternative Gene Name: LPAAT-alpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034254: 89%, ENSRNOG00000000437: 93%
Entrez Gene ID: 10554
Uniprot ID: Q99943
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPG
Gene Sequence GQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPG
Gene ID - Mouse ENSMUSG00000034254
Gene ID - Rat ENSRNOG00000000437
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AGPAT1 pAb (ATL-HPA048478)
Datasheet Anti AGPAT1 pAb (ATL-HPA048478) Datasheet (External Link)
Vendor Page Anti AGPAT1 pAb (ATL-HPA048478) at Atlas Antibodies

Documents & Links for Anti AGPAT1 pAb (ATL-HPA048478)
Datasheet Anti AGPAT1 pAb (ATL-HPA048478) Datasheet (External Link)
Vendor Page Anti AGPAT1 pAb (ATL-HPA048478)