Anti AGO2 pAb (ATL-HPA058075)

Atlas Antibodies

Catalog No.:
ATL-HPA058075-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: argonaute RISC catalytic component 2
Gene Name: AGO2
Alternative Gene Name: EIF2C2, hAGO2, Q10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036698: 94%, ENSRNOG00000008533: 94%
Entrez Gene ID: 27161
Uniprot ID: Q9UKV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IQGYAFKPPPRPDFGTSGRTIKLQANFFEMDI
Gene Sequence IQGYAFKPPPRPDFGTSGRTIKLQANFFEMDI
Gene ID - Mouse ENSMUSG00000036698
Gene ID - Rat ENSRNOG00000008533
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AGO2 pAb (ATL-HPA058075)
Datasheet Anti AGO2 pAb (ATL-HPA058075) Datasheet (External Link)
Vendor Page Anti AGO2 pAb (ATL-HPA058075) at Atlas Antibodies

Documents & Links for Anti AGO2 pAb (ATL-HPA058075)
Datasheet Anti AGO2 pAb (ATL-HPA058075) Datasheet (External Link)
Vendor Page Anti AGO2 pAb (ATL-HPA058075)
Citations for Anti AGO2 pAb (ATL-HPA058075) – 3 Found
Martini, Silvia; Davis, Khalil; Faraway, Rupert; Elze, Lisa; Lockwood, Nicola; Jones, Andrew; Xie, Xiao; McDonald, Neil Q; Mann, David J; Armstrong, Alan; Ule, Jernej; Parker, Peter J. A genetically-encoded crosslinker screen identifies SERBP1 as a PKCε substrate influencing translation and cell division. Nature Communications. 2021;12(1):6934.  PubMed
Lv, Yumei; Wang, Mingyi; Chen, Mingli; Wang, Dan; Luo, Mingyan; Zeng, Qingyuan. hsa_circ_0119412 overexpression promotes cervical cancer progression by targeting miR-217 to upregulate anterior gradient 2. Journal Of Clinical Laboratory Analysis. 2022;36(4):e24236.  PubMed
Bi, Yanghui; Guo, Shixing; Xu, Xiaoqin; Kong, Pengzhou; Cui, Heyang; Yan, Ting; Ma, Yanchun; Cheng, Yikun; Chen, Yunqing; Liu, Xue; Zhang, Ling; Cheng, Caixia; Xu, Enwei; Qian, Yu; Yang, Jian; Song, Bin; Li, Hongyi; Wang, Fang; Hu, Xiaoling; Liu, Xiangchen; Niu, Xia; Zhai, Yuanfang; Liu, Jing; Li, Yaoping; Cheng, Xiaolong; Cui, Yongping. Decreased ZNF750 promotes angiogenesis in a paracrine manner via activating DANCR/miR-4707-3p/FOXC2 axis in esophageal squamous cell carcinoma. Cell Death & Disease. 2020;11(4):296.  PubMed