Anti AGO1 pAb (ATL-HPA067849)

Atlas Antibodies

Catalog No.: ATL-HPA067849-25

Protein Description: argonaute 1, RISC catalytic component
Gene Name: AGO1
Alternative Gene Name: EIF2C1, hAGO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041530: 100%, ENSRNOG00000055915: 100%
Entrez Gene ID: 26523
Uniprot ID: Q9UL18
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQEEIS
• Gene Sequence: HLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQEEIS
• Gene ID - Mouse: ENSMUSG00000041530
• Gene ID - Rat: ENSRNOG00000055915
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.