Anti AGO1 pAb (ATL-HPA067849)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067849-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: AGO1
Alternative Gene Name: EIF2C1, hAGO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041530: 100%, ENSRNOG00000055915: 100%
Entrez Gene ID: 26523
Uniprot ID: Q9UL18
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQEEIS |
| Gene Sequence | HLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQEEIS |
| Gene ID - Mouse | ENSMUSG00000041530 |
| Gene ID - Rat | ENSRNOG00000055915 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AGO1 pAb (ATL-HPA067849) | |
| Datasheet | Anti AGO1 pAb (ATL-HPA067849) Datasheet (External Link) |
| Vendor Page | Anti AGO1 pAb (ATL-HPA067849) at Atlas Antibodies |
| Documents & Links for Anti AGO1 pAb (ATL-HPA067849) | |
| Datasheet | Anti AGO1 pAb (ATL-HPA067849) Datasheet (External Link) |
| Vendor Page | Anti AGO1 pAb (ATL-HPA067849) |