Anti AGO1 pAb (ATL-HPA067849)

Atlas Antibodies

Catalog No.:
ATL-HPA067849-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: argonaute 1, RISC catalytic component
Gene Name: AGO1
Alternative Gene Name: EIF2C1, hAGO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041530: 100%, ENSRNOG00000055915: 100%
Entrez Gene ID: 26523
Uniprot ID: Q9UL18
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQEEIS
Gene Sequence HLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQEEIS
Gene ID - Mouse ENSMUSG00000041530
Gene ID - Rat ENSRNOG00000055915
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AGO1 pAb (ATL-HPA067849)
Datasheet Anti AGO1 pAb (ATL-HPA067849) Datasheet (External Link)
Vendor Page Anti AGO1 pAb (ATL-HPA067849) at Atlas Antibodies

Documents & Links for Anti AGO1 pAb (ATL-HPA067849)
Datasheet Anti AGO1 pAb (ATL-HPA067849) Datasheet (External Link)
Vendor Page Anti AGO1 pAb (ATL-HPA067849)