Anti AGMAT pAb (ATL-HPA028321 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA028321-25
  • Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-AGMAT antibody. Corresponding AGMAT RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: agmatine ureohydrolase (agmatinase)
Gene Name: AGMAT
Alternative Gene Name: FLJ23384
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040706: 90%, ENSRNOG00000012315: 88%
Entrez Gene ID: 79814
Uniprot ID: Q9BSE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRCVDEGLLDCKRVVQIGIRGSSTTLDPYRYNRSQGFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDI
Gene Sequence RRCVDEGLLDCKRVVQIGIRGSSTTLDPYRYNRSQGFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDI
Gene ID - Mouse ENSMUSG00000040706
Gene ID - Rat ENSRNOG00000012315
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AGMAT pAb (ATL-HPA028321 w/enhanced validation)
Datasheet Anti AGMAT pAb (ATL-HPA028321 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AGMAT pAb (ATL-HPA028321 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AGMAT pAb (ATL-HPA028321 w/enhanced validation)
Datasheet Anti AGMAT pAb (ATL-HPA028321 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AGMAT pAb (ATL-HPA028321 w/enhanced validation)